Panthera pardus (leopard): 109270887 Help Entry 109270887         CDS       T06062                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism ppad  Panthera pardus (leopard) Pathway ppad04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ppad00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     109270887  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppad03019]     109270887    03029 Mitochondrial biogenesis [BR:ppad03029]     109270887 Messenger RNA biogenesis [BR:ppad03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      109270887 Mitochondrial biogenesis [BR:ppad03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     109270887 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  109270887 NCBI-ProteinID:  XP_019311435 Ensembl:  ENSPPRG00000000324 UniProt:  A0A9V1FY26 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPDCSCATGGSCSCAGSCKCKACRCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcccgactgctcctgcgccaccggtggctcctgctcgtgcgccggctcctgcaaa tgcaaagcctgcagatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcatctgcaaaggggcatcggacaagtgcagctgctgc gcctaa

DBGET integrated database retrieval system