Panthera pardus (leopard): 109272592 Help Entry 109272592         CDS       T06062                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ppad  Panthera pardus (leopard) Pathway ppad01521   EGFR tyrosine kinase inhibitor resistance ppad01524   Platinum drug resistance ppad04014   Ras signaling pathway ppad04064   NF-kappa B signaling pathway ppad04115   p53 signaling pathway ppad04137   Mitophagy - animal ppad04140   Autophagy - animal ppad04151   PI3K-Akt signaling pathway ppad04210   Apoptosis ppad04215   Apoptosis - multiple species ppad04621   NOD-like receptor signaling pathway ppad04630   JAK-STAT signaling pathway ppad05012   Parkinson disease ppad05014   Amyotrophic lateral sclerosis ppad05022   Pathways of neurodegeneration - multiple diseases ppad05145   Toxoplasmosis ppad05162   Measles ppad05166   Human T-cell leukemia virus 1 infection ppad05168   Herpes simplex virus 1 infection ppad05170   Human immunodeficiency virus 1 infection ppad05200   Pathways in cancer ppad05202   Transcriptional misregulation in cancer ppad05212   Pancreatic cancer ppad05220   Chronic myeloid leukemia ppad05222   Small cell lung cancer ppad05225   Hepatocellular carcinoma ppad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109272592 (BCL2L1)    04630 JAK-STAT signaling pathway     109272592 (BCL2L1)    04064 NF-kappa B signaling pathway     109272592 (BCL2L1)    04151 PI3K-Akt signaling pathway     109272592 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109272592 (BCL2L1)    04137 Mitophagy - animal     109272592 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     109272592 (BCL2L1)    04215 Apoptosis - multiple species     109272592 (BCL2L1)    04115 p53 signaling pathway     109272592 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109272592 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109272592 (BCL2L1)    05202 Transcriptional misregulation in cancer     109272592 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     109272592 (BCL2L1)    05225 Hepatocellular carcinoma     109272592 (BCL2L1)    05220 Chronic myeloid leukemia     109272592 (BCL2L1)    05222 Small cell lung cancer     109272592 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109272592 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     109272592 (BCL2L1)    05162 Measles     109272592 (BCL2L1)    05168 Herpes simplex virus 1 infection     109272592 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109272592 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     109272592 (BCL2L1)    05014 Amyotrophic lateral sclerosis     109272592 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     109272592 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109272592 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109272592 (BCL2L1)    01524 Platinum drug resistance     109272592 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ppad01009]     109272592 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppad03036]     109272592 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ppad02000]     109272592 (BCL2L1) Protein phosphatases and associated proteins [BR:ppad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      109272592 (BCL2L1) Chromosome and associated proteins [BR:ppad03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     109272592 (BCL2L1) Transporters [BR:ppad02000]  Other transporters   Pores ion channels [TC:1]    109272592 (BCL2L1) SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  109272592 NCBI-ProteinID:  XP_019314400 Ensembl:  ENSPPRG00000022980 UniProt:  A0A9V1G4Z3 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg accgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system