Panthera pardus (leopard): 109273783 Help Entry 109273783         CDS       T06062                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism ppad  Panthera pardus (leopard) Pathway ppad04014   Ras signaling pathway ppad04015   Rap1 signaling pathway ppad04020   Calcium signaling pathway ppad04022   cGMP-PKG signaling pathway ppad04024   cAMP signaling pathway ppad04070   Phosphatidylinositol signaling system ppad04114   Oocyte meiosis ppad04218   Cellular senescence ppad04261   Adrenergic signaling in cardiomyocytes ppad04270   Vascular smooth muscle contraction ppad04371   Apelin signaling pathway ppad04625   C-type lectin receptor signaling pathway ppad04713   Circadian entrainment ppad04720   Long-term potentiation ppad04722   Neurotrophin signaling pathway ppad04728   Dopaminergic synapse ppad04740   Olfactory transduction ppad04744   Phototransduction ppad04750   Inflammatory mediator regulation of TRP channels ppad04910   Insulin signaling pathway ppad04912   GnRH signaling pathway ppad04915   Estrogen signaling pathway ppad04916   Melanogenesis ppad04921   Oxytocin signaling pathway ppad04922   Glucagon signaling pathway ppad04924   Renin secretion ppad04925   Aldosterone synthesis and secretion ppad04970   Salivary secretion ppad04971   Gastric acid secretion ppad05010   Alzheimer disease ppad05012   Parkinson disease ppad05022   Pathways of neurodegeneration - multiple diseases ppad05031   Amphetamine addiction ppad05034   Alcoholism ppad05133   Pertussis ppad05152   Tuberculosis ppad05163   Human cytomegalovirus infection ppad05167   Kaposi sarcoma-associated herpesvirus infection ppad05170   Human immunodeficiency virus 1 infection ppad05200   Pathways in cancer ppad05214   Glioma ppad05417   Lipid and atherosclerosis ppad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109273783    04015 Rap1 signaling pathway     109273783    04371 Apelin signaling pathway     109273783    04020 Calcium signaling pathway     109273783    04070 Phosphatidylinositol signaling system     109273783    04024 cAMP signaling pathway     109273783    04022 cGMP-PKG signaling pathway     109273783  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109273783    04218 Cellular senescence     109273783  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109273783   09152 Endocrine system    04910 Insulin signaling pathway     109273783    04922 Glucagon signaling pathway     109273783    04912 GnRH signaling pathway     109273783    04915 Estrogen signaling pathway     109273783    04921 Oxytocin signaling pathway     109273783    04916 Melanogenesis     109273783    04924 Renin secretion     109273783    04925 Aldosterone synthesis and secretion     109273783   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109273783    04270 Vascular smooth muscle contraction     109273783   09154 Digestive system    04970 Salivary secretion     109273783    04971 Gastric acid secretion     109273783   09156 Nervous system    04728 Dopaminergic synapse     109273783    04720 Long-term potentiation     109273783    04722 Neurotrophin signaling pathway     109273783   09157 Sensory system    04744 Phototransduction     109273783    04740 Olfactory transduction     109273783    04750 Inflammatory mediator regulation of TRP channels     109273783   09159 Environmental adaptation    04713 Circadian entrainment     109273783  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109273783   09162 Cancer: specific types    05214 Glioma     109273783   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109273783    05163 Human cytomegalovirus infection     109273783    05167 Kaposi sarcoma-associated herpesvirus infection     109273783   09171 Infectious disease: bacterial    05133 Pertussis     109273783    05152 Tuberculosis     109273783   09164 Neurodegenerative disease    05010 Alzheimer disease     109273783    05012 Parkinson disease     109273783    05022 Pathways of neurodegeneration - multiple diseases     109273783   09165 Substance dependence    05031 Amphetamine addiction     109273783    05034 Alcoholism     109273783   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109273783    05418 Fluid shear stress and atherosclerosis     109273783  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ppad01009]     109273783   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppad04131]     109273783    03036 Chromosome and associated proteins [BR:ppad03036]     109273783   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109273783 Protein phosphatases and associated proteins [BR:ppad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109273783 Membrane trafficking [BR:ppad04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109273783 Chromosome and associated proteins [BR:ppad03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109273783 Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109273783 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH Dockerin_1 EF_EFCAB10_C Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin DUF5580_M SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  109273783 NCBI-ProteinID:  XP_019316434 Ensembl:  ENSPPRG00000021341 UniProt:  A0A9V1G745 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacggaggaacaggtggccgagttcagggaggccttctgcctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctccgggacatggtgggcgagatcgaccgtgacggc aatggctccgtggacttccctgagttcctgggcatgatggcccggcagctgaggggcagg gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgacgac gaggtggacgagatgatccgggccgccgacgtggacggggacggccaggtcaactacgag gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system