KEGG   Panthera pardus (leopard): 109273877
Entry
109273877         CDS       T06062                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109273877 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ppad04050]
    109273877 (TNFRSF8)
   04090 CD molecules [BR:ppad04090]
    109273877 (TNFRSF8)
Cytokine receptors [BR:ppad04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109273877 (TNFRSF8)
CD molecules [BR:ppad04090]
 Proteins
  109273877 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 109273877
NCBI-ProteinID: XP_019316515
UniProt: A0A6P4WXZ9
LinkDB
Position
Unknown
AA seq 808 aa
MRPLGAVLGLLLLGVLGAFPQDRVPRDVYAGDPGHHHDKTAGLPCPQGSPDCRKQCEPDY
YLNRDGRCTACVSCARDDLVEKMPCSGNSSRVCECRAGTFCATSATNSCARCIPHTVCPK
GMIVKVQGTAQMDTVCERPSPVTSPDLGTGPEDCQAPTSDTSAQARPLVTSVSSSARTTL
LGGGTAITPEDDSNMTGAPGSPSSVRKPSPDPGLTPQPPCPQGSPDCRKQCEPDYYLDRD
GRCTACVSCARDDLVEKMPCSGNSSRVCECRAGTFCATSATNSCARCIPHTVCPKGMIVK
VQGTAQMDTVCERPSPVTSPDLGTGPEDCQAPTSDTSAQAGPLVTSVSSSARTTLLGGGT
AITPEDDSKMTGAPGSPSSVRKPSPDPGLTPQPPCPQGSPDCRKQCEPDYYLDRDGRCTA
CVSCAQDDLVEKTPCTWNSSRVCECRPGMFCVTPVTNSCAHCVTRPVCPPGMATKPQGTA
ERDATHEPPPPLEAHPECSTNPEDSSLTPILRPLPAGTAERDATHEPPPPLEAHPECSTN
PEDSKAPTSATASPVSAADPQGSKEHGGGNTHTWGDTFTSTSSPISFSSTGKPILVSGPV
LFWMVMILVVVLVSISFLLCHWRACRKWIRQKLHLCYPAQTFRPTLEPVDSRPRRNLTQL
RSCISVAEPGTEELGLMGPPVMETCPNGEVCLESMRLLDASPAGSPPSPRDLPEPRVTSE
HTNNRIEKIYIMKADTVIVGTVRTEVPEGRGLAGPTGPELEEDLEGDHAYPHFPEQETEP
PLGSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgcgccccctcggcgctgtgctgggactgctgctcctgggggtgctgggagccttcccg
caggatcgagttccgagggacgtctatgctggagaccctggccaccatcatgacaaaact
gccgggctgccgtgcccccaggggtcacctgactgcaggaagcagtgtgagcccgactac
tacctgaacagggacggccgctgcacggcctgtgtgagctgtgctcgagatgatcttgtg
gagaagatgccgtgctcagggaactcctcccgcgtctgtgagtgccgcgctggcacgttc
tgtgccacatcagccaccaactcctgtgcccgctgcatcccccacaccgtctgcccgaaa
gggatgattgtcaaggtccagggcacagcacagatggatactgtgtgtgagcggccttcc
ccggtgaccagccctgacctcggcacgggcccagaagactgccaggcgcccaccagcgac
accagcgcccaggccaggcccctggtgacctcagtgagctccagtgccaggaccacgctc
cttggagggggcactgccatcacccctgaagatgattccaatatgacgggggcccccggc
tctccctcctctgtgaggaagcccagtccagatccagggctgaccccgcagccgccgtgc
ccccaggggtcacctgactgtaggaagcagtgtgagcccgactactacctggacagggac
ggccgctgcacggcctgtgtgagctgtgctcgagacgatcttgtggagaagatgccgtgc
tcagggaactcctcccgcgtctgtgagtgccgcgctggcacgttctgtgccacatcagcc
accaactcctgtgcccgctgcatcccccacaccgtctgcccgaaagggatgattgtcaag
gtccagggcacagcacagatggatactgtgtgtgagcggccttccccggtgaccagccct
gacctcggcacgggcccagaagactgccaggcgcccaccagcgacaccagcgcccaggcc
gggcccctggtgacctcagtgagctccagtgccaggaccacgctccttggagggggcact
gccatcacccccgaagatgattccaaaatgacgggggcccccggttctccctcctctgtg
aggaagcccagtccagatccagggctgaccccacagccgccgtgtccccaggggtcacct
gactgtaggaagcagtgtgagcccgactactacctggacagggacggccgctgcacggcc
tgtgtgagctgtgctcaagatgacctggtggagaagacaccctgtacctggaactcctct
cgtgtctgcgaatgtcgacctggcatgttctgtgtcacaccagtcaccaactcctgtgcc
cactgtgtcacccgccccgtctgcccaccaggcatggccaccaaaccccaaggtacagct
gagagggatgccacccatgagccgccgcctcccctagaagcccaccccgagtgcagcacc
aacccagaggacagctccttgacaccgattctacgaccactccctgcaggtacagctgag
agggatgccacccatgagccgccgcctcccctagaagcccaccccgagtgcagcaccaac
ccagaggacagcaaggcgcccaccagcgccacggcctctccggtctccgcagcagacccc
caaggcagtaaggagcatggagggggcaacacccacacctggggagacaccttcacatca
acgagctcccctatctctttctcctccacgggaaagcccattctggtttcaggacctgtg
ctcttctggatggtcatgatcctggtggtggtcttggtctccatctccttcctcctgtgc
cactggagggcctgcaggaagtggattcggcagaagctccacctgtgctaccctgcccag
accttccggcccacgctggagcctgtggattccaggcccaggaggaacctgacccagttg
aggagttgcatatcggtggccgagccgggcacagaggagctgggattaatgggccccccg
gtcatggagacctgccccaacggggaagtctgcctggagagcatgcggctgctggatgcc
agcccggccgggagccccccatcccccagggaccttcccgagccccgggtgacctcagag
cataccaacaacaggatcgagaaaatctacatcatgaaggctgacacagtgattgtgggg
accgtgaggaccgaggtgcctgagggccggggcctggcggggccgacggggcctgaattg
gaggaggatctggaaggggaccacgcgtacccccacttcccggagcaggagacagagccg
cctctgggcagctgcggggacgtcatgttctcagtagaagaggaaggaaaggaggccccc
ttgcccatgactgtctctgagaaatga

DBGET integrated database retrieval system