Panthera pardus (leopard): 109275291 Help Entry 109275291         CDS       T06062                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism ppad  Panthera pardus (leopard) Pathway ppad04024   cAMP signaling pathway ppad04080   Neuroactive ligand-receptor interaction ppad04081   Hormone signaling ppad04935   Growth hormone synthesis, secretion and action ppad04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ppad00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     109275291 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109275291 (SST)    04081 Hormone signaling     109275291 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     109275291 (SST)   09154 Digestive system    04971 Gastric acid secretion     109275291 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppad04052]     109275291 (SST) Cytokines and neuropeptides [BR:ppad04052]  Neuropeptides   GPCR binding    109275291 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  109275291 NCBI-ProteinID:  XP_019319023 Ensembl:  ENSPPRG00000001065 UniProt:  A0A9V1GB77 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatcctcgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcggagctcctgtctgaaccc aaccagacagagaacgatgccctggaacccgaagacttgtcccaggcggctgagcaggat gaaatgaggctggaactgcagagatccactaactcaaaccctgccatggcaccccgagaa cgcaaagccggctgcaagaatttcttctggaagactttcacttcctgttag

DBGET integrated database retrieval system