Pseudomonas palleroniana: LDL65_09885 Help Entry LDL65_09885       CDS       T09728                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism ppae  Pseudomonas palleroniana Brite KEGG Orthology (KO) [BR:ppae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppae03036]     LDL65_09885 Chromosome and associated proteins [BR:ppae03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LDL65_09885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament Asd-4 ZapB VGPC1_C Macoilin TPR_MLP1_2 Motif Other DBs NCBI-ProteinID:  UOP12832 LinkDB All DBs Position 2097485..2097694 Genome browser AA seq 69 aa AA seqDB search MEDTDLQALMARLELLIDRVEQLKSQNGLLLAQEKTWREERAHLIEKNEIARRKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacaccgacctgcaagcgctgatggccagactcgaactgctaattgatcgggtc gagcaacttaagagtcaaaacggactcctattagctcaggaaaagacctggcgcgaggaa cgcgctcacctcattgaaaaaaacgaaatcgcccggcgtaaggtcgaatcgatgatttcg cgcctgaaggccctggagcaagactcatga

DBGET integrated database retrieval system