Pseudomonas palleroniana: LDL65_17575 Help Entry LDL65_17575       CDS       T09728                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism ppae  Pseudomonas palleroniana Brite KEGG Orthology (KO) [BR:ppae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppae03036]     LDL65_17575 (ftsB) Chromosome and associated proteins [BR:ppae03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LDL65_17575 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ACCA_BT YabA Motif Other DBs NCBI-ProteinID:  UOP08906 LinkDB All DBs Position 3834762..3835040 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSFAQVEELTQQIADQHAENERLLERNRVLDAEV LELKKGTETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttattcctcgtcttgctcttgttgctggctggcctgcagtac cgcctatgggtcggtaatggcagctttgcgcaggtagaagaactgacccagcagattgcc gaccagcacgccgaaaacgaacgcctgctggagcgtaatcgcgtccttgacgccgaagta cttgagctgaaaaaaggtacggagaccgttgaagagcgggctcgtcatgaattgggcatg gtcaaggagggtgaaaccctctaccagttggcccaatga

DBGET integrated database retrieval system