Paraburkholderia pallida: E1956_01180 Help Entry E1956_01180       CDS       T09864                                  Name (GenBank) hypothetical protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism ppai  Paraburkholderia pallida Brite KEGG Orthology (KO) [BR:ppai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ppai03000]     E1956_01180    03036 Chromosome and associated proteins [BR:ppai03036]     E1956_01180    03400 DNA repair and recombination proteins [BR:ppai03400]     E1956_01180 Transcription factors [BR:ppai03000]  Prokaryotic type   Helix-turn-helix    Other families     E1956_01180 Chromosome and associated proteins [BR:ppai03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     E1956_01180 DNA repair and recombination proteins [BR:ppai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       E1956_01180 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_1 HTH_30 HTH_28 HTH_23 UBA FAM177 Motif Other DBs NCBI-ProteinID:  QBQ98440 UniProt:  A0A4P7CRD0 LinkDB All DBs Position 1:283827..284057 Genome browser AA seq 76 aa AA seqDB search MEGPEIGGTAPSAMPVRDAAAATDVRPLRDQEGAAVRQALEACRYNVTRCASLLGISKPA LYAKIKRYRIVLERPL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaaggacccgagattggtggaaccgccccttcagccatgcccgtgcgagacgccgcc gctgcaaccgatgtgcgtccgctacgcgatcaggaaggcgccgcagtacgccaggccctt gaggcctgtcgatacaacgtgacgcgctgcgcatcactactggggatatccaagcccgca ctttacgcaaaaatcaaacgttaccgaatcgttcttgagcgaccgctttaa

DBGET integrated database retrieval system