Paraburkholderia pallida: E1956_10335 Help Entry E1956_10335       CDS       T09864                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppai  Paraburkholderia pallida Brite KEGG Orthology (KO) [BR:ppai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppai03032]     E1956_10335    03036 Chromosome and associated proteins [BR:ppai03036]     E1956_10335    03400 DNA repair and recombination proteins [BR:ppai03400]     E1956_10335 DNA replication proteins [BR:ppai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E1956_10335 Chromosome and associated proteins [BR:ppai03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E1956_10335 DNA repair and recombination proteins [BR:ppai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E1956_10335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 UBA_HYPK Motif Other DBs NCBI-ProteinID:  QBQ97535 UniProt:  A0A4P7CNX2 LinkDB All DBs Position 1:2277634..2277906 Genome browser AA seq 90 aa AA seqDB search MNKTELIDHIAQQADISKLAAGRALDAVIGGVKNTLKKGGSVTLIGFGTFAVGKRTARTG RNPRTGAAIKIKAAKVPKFRPGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacggaattgatcgatcacatcgcgcagcaggccgacatctcaaaattagct gcgggacgcgcactcgatgccgtgatcggtggtgtcaaaaatacgttgaagaagggcggc tcggtcacgctgatcggcttcggcaccttcgcggtcggcaagcgtacggcgcgtacgggg cgcaatccgcgcacgggcgcggcgatcaaaatcaaggcggcaaaagttcctaaattcagg cctggcaaagcactcaaagatgcgctaaactaa

DBGET integrated database retrieval system