Paraburkholderia pallida: E1956_19560 Help Entry E1956_19560       CDS       T09864                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism ppai  Paraburkholderia pallida Brite KEGG Orthology (KO) [BR:ppai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppai03036]     E1956_19560    03400 DNA repair and recombination proteins [BR:ppai03400]     E1956_19560 Chromosome and associated proteins [BR:ppai03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     E1956_19560 DNA repair and recombination proteins [BR:ppai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       E1956_19560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SIMPL Motif Other DBs NCBI-ProteinID:  QBQ99390 UniProt:  A0A4P7CTQ7 LinkDB All DBs Position 2:962184..962456 Genome browser AA seq 90 aa AA seqDB search MATYLELLAEKRALDARIEALRAEAAQDALAAARAAIAEFGFTAEDLFGKPRQQKGTRGA QRRPKDAQDSAAASAADQANFDLFGDAAGH NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctacctacctcgaattgctcgccgaaaaacgcgcgctggacgcgcgcatcgaagcg ttgcgcgccgaggcggctcaagacgcgctcgcggccgcccgtgccgccatcgccgaattc ggcttcacggcggaagacctgttcggcaagccgcgccagcaaaaaggcacgcggggcgcg cagcgcaggcccaaggacgcgcaagacagcgccgcggcgtcggccgccgatcaggcaaac ttcgatctgttcggcgacgctgccgggcactga

DBGET integrated database retrieval system