Paraburkholderia pallida: E1956_38715 Help Entry E1956_38715       CDS       T09864                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppai  Paraburkholderia pallida Brite KEGG Orthology (KO) [BR:ppai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppai03032]     E1956_38715    03036 Chromosome and associated proteins [BR:ppai03036]     E1956_38715    03400 DNA repair and recombination proteins [BR:ppai03400]     E1956_38715 DNA replication proteins [BR:ppai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E1956_38715 Chromosome and associated proteins [BR:ppai03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E1956_38715 DNA repair and recombination proteins [BR:ppai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E1956_38715 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Urease_beta HU-CCDC81_euk_1 DUF2267 Nup214_FG Motif Other DBs NCBI-ProteinID:  QBR03108 UniProt:  A0A4P7D4Y0 LinkDB All DBs Position 4:complement(871593..871871) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAASTGETKAATGAAIDAILEVVTKAVTSGDSVQLVGFGSFSTGQRAARVG RNPATGAEIQIAAAKTVKFTAGKAFKDAVNAA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactcattgacgcagtcgccgcaagcacgggcgagaccaaggcagcc accggagccgcaatcgacgcgatcctcgaagtggtcaccaaggcggtcacgtcgggcgat tccgtgcagctcgtcggcttcggctcgttctcgaccggccagcgtgctgctcgtgtgggc cgcaacccggctacgggcgcggaaatccagatcgctgcggcgaagacggtgaagttcacg gccggcaaggctttcaaggacgccgtcaacgcggcgtga

DBGET integrated database retrieval system