Pyxidicoccus parkwayensis: JY651_32520 Help Entry JY651_32520       CDS       T09992                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ppak  Pyxidicoccus parkwayensis Pathway ppak01100   Metabolic pathways ppak01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppak00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JY651_32520    00074 Mycolic acid biosynthesis     JY651_32520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JY651_32520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF742 Motif Other DBs NCBI-ProteinID:  QSQ19986 UniProt:  A0ABX7NNG9 LinkDB All DBs Position 8620932..8621204 Genome browser AA seq 90 aa AA seqDB search MQTRSDSDLILNAVVAATRAACRLPLPDVIAREHCFVTDLGFDSMSIARLALELEDRVQQ PVLLDDWIASEPDPSALTVGSLCNYVAALG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccaggagcgacagcgatttgattctcaatgccgtggtggccgcgacacgcgcc gcctgccggctgcccctgcccgacgtcatcgcccgcgagcattgtttcgtcaccgacctg ggcttcgactcgatgagcattgcccggctcgcgctggagctggaggaccgcgtccagcaa cccgtgctgctggacgactggattgcgagcgagccggacccgtccgcgctcaccgtgggc tcgctgtgcaactacgtcgcggcgctggggtag

DBGET integrated database retrieval system