KEGG   Pteronotus mesoamericanus (Parnell's mustached bat): 129063946
Entry
129063946         CDS       T09558                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
ppam  Pteronotus mesoamericanus (Parnell's mustached bat)
Pathway
ppam01521  EGFR tyrosine kinase inhibitor resistance
ppam01522  Endocrine resistance
ppam04010  MAPK signaling pathway
ppam04012  ErbB signaling pathway
ppam04014  Ras signaling pathway
ppam04015  Rap1 signaling pathway
ppam04062  Chemokine signaling pathway
ppam04068  FoxO signaling pathway
ppam04071  Sphingolipid signaling pathway
ppam04072  Phospholipase D signaling pathway
ppam04137  Mitophagy - animal
ppam04140  Autophagy - animal
ppam04150  mTOR signaling pathway
ppam04151  PI3K-Akt signaling pathway
ppam04210  Apoptosis
ppam04211  Longevity regulating pathway
ppam04213  Longevity regulating pathway - multiple species
ppam04218  Cellular senescence
ppam04360  Axon guidance
ppam04370  VEGF signaling pathway
ppam04371  Apelin signaling pathway
ppam04540  Gap junction
ppam04550  Signaling pathways regulating pluripotency of stem cells
ppam04625  C-type lectin receptor signaling pathway
ppam04650  Natural killer cell mediated cytotoxicity
ppam04660  T cell receptor signaling pathway
ppam04662  B cell receptor signaling pathway
ppam04664  Fc epsilon RI signaling pathway
ppam04714  Thermogenesis
ppam04720  Long-term potentiation
ppam04722  Neurotrophin signaling pathway
ppam04725  Cholinergic synapse
ppam04726  Serotonergic synapse
ppam04730  Long-term depression
ppam04810  Regulation of actin cytoskeleton
ppam04910  Insulin signaling pathway
ppam04912  GnRH signaling pathway
ppam04915  Estrogen signaling pathway
ppam04916  Melanogenesis
ppam04917  Prolactin signaling pathway
ppam04919  Thyroid hormone signaling pathway
ppam04921  Oxytocin signaling pathway
ppam04926  Relaxin signaling pathway
ppam04929  GnRH secretion
ppam04933  AGE-RAGE signaling pathway in diabetic complications
ppam04935  Growth hormone synthesis, secretion and action
ppam05010  Alzheimer disease
ppam05022  Pathways of neurodegeneration - multiple diseases
ppam05034  Alcoholism
ppam05160  Hepatitis C
ppam05161  Hepatitis B
ppam05163  Human cytomegalovirus infection
ppam05165  Human papillomavirus infection
ppam05166  Human T-cell leukemia virus 1 infection
ppam05167  Kaposi sarcoma-associated herpesvirus infection
ppam05170  Human immunodeficiency virus 1 infection
ppam05200  Pathways in cancer
ppam05203  Viral carcinogenesis
ppam05205  Proteoglycans in cancer
ppam05206  MicroRNAs in cancer
ppam05207  Chemical carcinogenesis - receptor activation
ppam05208  Chemical carcinogenesis - reactive oxygen species
ppam05210  Colorectal cancer
ppam05211  Renal cell carcinoma
ppam05213  Endometrial cancer
ppam05214  Glioma
ppam05215  Prostate cancer
ppam05216  Thyroid cancer
ppam05218  Melanoma
ppam05219  Bladder cancer
ppam05220  Chronic myeloid leukemia
ppam05221  Acute myeloid leukemia
ppam05223  Non-small cell lung cancer
ppam05224  Breast cancer
ppam05225  Hepatocellular carcinoma
ppam05226  Gastric cancer
ppam05230  Central carbon metabolism in cancer
ppam05231  Choline metabolism in cancer
ppam05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ppam05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129063946 (NRAS)
   04012 ErbB signaling pathway
    129063946 (NRAS)
   04014 Ras signaling pathway
    129063946 (NRAS)
   04015 Rap1 signaling pathway
    129063946 (NRAS)
   04370 VEGF signaling pathway
    129063946 (NRAS)
   04371 Apelin signaling pathway
    129063946 (NRAS)
   04068 FoxO signaling pathway
    129063946 (NRAS)
   04072 Phospholipase D signaling pathway
    129063946 (NRAS)
   04071 Sphingolipid signaling pathway
    129063946 (NRAS)
   04151 PI3K-Akt signaling pathway
    129063946 (NRAS)
   04150 mTOR signaling pathway
    129063946 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129063946 (NRAS)
   04137 Mitophagy - animal
    129063946 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    129063946 (NRAS)
   04218 Cellular senescence
    129063946 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    129063946 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    129063946 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129063946 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    129063946 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    129063946 (NRAS)
   04660 T cell receptor signaling pathway
    129063946 (NRAS)
   04662 B cell receptor signaling pathway
    129063946 (NRAS)
   04664 Fc epsilon RI signaling pathway
    129063946 (NRAS)
   04062 Chemokine signaling pathway
    129063946 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129063946 (NRAS)
   04929 GnRH secretion
    129063946 (NRAS)
   04912 GnRH signaling pathway
    129063946 (NRAS)
   04915 Estrogen signaling pathway
    129063946 (NRAS)
   04917 Prolactin signaling pathway
    129063946 (NRAS)
   04921 Oxytocin signaling pathway
    129063946 (NRAS)
   04926 Relaxin signaling pathway
    129063946 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    129063946 (NRAS)
   04919 Thyroid hormone signaling pathway
    129063946 (NRAS)
   04916 Melanogenesis
    129063946 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    129063946 (NRAS)
   04726 Serotonergic synapse
    129063946 (NRAS)
   04720 Long-term potentiation
    129063946 (NRAS)
   04730 Long-term depression
    129063946 (NRAS)
   04722 Neurotrophin signaling pathway
    129063946 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    129063946 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    129063946 (NRAS)
   04213 Longevity regulating pathway - multiple species
    129063946 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    129063946 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129063946 (NRAS)
   05206 MicroRNAs in cancer
    129063946 (NRAS)
   05205 Proteoglycans in cancer
    129063946 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    129063946 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    129063946 (NRAS)
   05203 Viral carcinogenesis
    129063946 (NRAS)
   05230 Central carbon metabolism in cancer
    129063946 (NRAS)
   05231 Choline metabolism in cancer
    129063946 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129063946 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129063946 (NRAS)
   05225 Hepatocellular carcinoma
    129063946 (NRAS)
   05226 Gastric cancer
    129063946 (NRAS)
   05214 Glioma
    129063946 (NRAS)
   05216 Thyroid cancer
    129063946 (NRAS)
   05221 Acute myeloid leukemia
    129063946 (NRAS)
   05220 Chronic myeloid leukemia
    129063946 (NRAS)
   05218 Melanoma
    129063946 (NRAS)
   05211 Renal cell carcinoma
    129063946 (NRAS)
   05219 Bladder cancer
    129063946 (NRAS)
   05215 Prostate cancer
    129063946 (NRAS)
   05213 Endometrial cancer
    129063946 (NRAS)
   05224 Breast cancer
    129063946 (NRAS)
   05223 Non-small cell lung cancer
    129063946 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129063946 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    129063946 (NRAS)
   05161 Hepatitis B
    129063946 (NRAS)
   05160 Hepatitis C
    129063946 (NRAS)
   05163 Human cytomegalovirus infection
    129063946 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129063946 (NRAS)
   05165 Human papillomavirus infection
    129063946 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129063946 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    129063946 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    129063946 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129063946 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    129063946 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129063946 (NRAS)
   01522 Endocrine resistance
    129063946 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppam04131]
    129063946 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppam04147]
    129063946 (NRAS)
   04031 GTP-binding proteins [BR:ppam04031]
    129063946 (NRAS)
Membrane trafficking [BR:ppam04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    129063946 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    129063946 (NRAS)
Exosome [BR:ppam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129063946 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   129063946 (NRAS)
  Exosomal proteins of breast cancer cells
   129063946 (NRAS)
  Exosomal proteins of colorectal cancer cells
   129063946 (NRAS)
GTP-binding proteins [BR:ppam04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    129063946 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 129063946
NCBI-ProteinID: XP_054421039
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaagcaggtggttatagacggtgaaacctgtctgttggacatcctggacacagcgggc
caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgt
gtgtttgccatcaacaatagcaagtcgtttgcagatattaacctctacagggaacagatt
aagagagtgaaagactcagatgatgtccctatggtgctagtgggaaacaagtgtgatttg
ccaacacggacagttgacacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agggaaatacgtcagtatcgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system