KEGG   Pteronotus mesoamericanus (Parnell's mustached bat): 129073113
Entry
129073113         CDS       T09558                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
ppam  Pteronotus mesoamericanus (Parnell's mustached bat)
Pathway
ppam01521  EGFR tyrosine kinase inhibitor resistance
ppam01522  Endocrine resistance
ppam04010  MAPK signaling pathway
ppam04012  ErbB signaling pathway
ppam04014  Ras signaling pathway
ppam04015  Rap1 signaling pathway
ppam04062  Chemokine signaling pathway
ppam04068  FoxO signaling pathway
ppam04071  Sphingolipid signaling pathway
ppam04072  Phospholipase D signaling pathway
ppam04137  Mitophagy - animal
ppam04140  Autophagy - animal
ppam04144  Endocytosis
ppam04150  mTOR signaling pathway
ppam04151  PI3K-Akt signaling pathway
ppam04210  Apoptosis
ppam04211  Longevity regulating pathway
ppam04213  Longevity regulating pathway - multiple species
ppam04218  Cellular senescence
ppam04360  Axon guidance
ppam04370  VEGF signaling pathway
ppam04371  Apelin signaling pathway
ppam04510  Focal adhesion
ppam04540  Gap junction
ppam04550  Signaling pathways regulating pluripotency of stem cells
ppam04625  C-type lectin receptor signaling pathway
ppam04630  JAK-STAT signaling pathway
ppam04650  Natural killer cell mediated cytotoxicity
ppam04660  T cell receptor signaling pathway
ppam04662  B cell receptor signaling pathway
ppam04664  Fc epsilon RI signaling pathway
ppam04714  Thermogenesis
ppam04720  Long-term potentiation
ppam04722  Neurotrophin signaling pathway
ppam04725  Cholinergic synapse
ppam04726  Serotonergic synapse
ppam04730  Long-term depression
ppam04810  Regulation of actin cytoskeleton
ppam04910  Insulin signaling pathway
ppam04912  GnRH signaling pathway
ppam04915  Estrogen signaling pathway
ppam04916  Melanogenesis
ppam04917  Prolactin signaling pathway
ppam04919  Thyroid hormone signaling pathway
ppam04921  Oxytocin signaling pathway
ppam04926  Relaxin signaling pathway
ppam04929  GnRH secretion
ppam04933  AGE-RAGE signaling pathway in diabetic complications
ppam04935  Growth hormone synthesis, secretion and action
ppam05010  Alzheimer disease
ppam05022  Pathways of neurodegeneration - multiple diseases
ppam05034  Alcoholism
ppam05132  Salmonella infection
ppam05160  Hepatitis C
ppam05161  Hepatitis B
ppam05163  Human cytomegalovirus infection
ppam05165  Human papillomavirus infection
ppam05166  Human T-cell leukemia virus 1 infection
ppam05167  Kaposi sarcoma-associated herpesvirus infection
ppam05170  Human immunodeficiency virus 1 infection
ppam05200  Pathways in cancer
ppam05203  Viral carcinogenesis
ppam05205  Proteoglycans in cancer
ppam05206  MicroRNAs in cancer
ppam05207  Chemical carcinogenesis - receptor activation
ppam05208  Chemical carcinogenesis - reactive oxygen species
ppam05210  Colorectal cancer
ppam05211  Renal cell carcinoma
ppam05213  Endometrial cancer
ppam05214  Glioma
ppam05215  Prostate cancer
ppam05216  Thyroid cancer
ppam05218  Melanoma
ppam05219  Bladder cancer
ppam05220  Chronic myeloid leukemia
ppam05221  Acute myeloid leukemia
ppam05223  Non-small cell lung cancer
ppam05224  Breast cancer
ppam05225  Hepatocellular carcinoma
ppam05226  Gastric cancer
ppam05230  Central carbon metabolism in cancer
ppam05231  Choline metabolism in cancer
ppam05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ppam05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129073113 (HRAS)
   04012 ErbB signaling pathway
    129073113 (HRAS)
   04014 Ras signaling pathway
    129073113 (HRAS)
   04015 Rap1 signaling pathway
    129073113 (HRAS)
   04370 VEGF signaling pathway
    129073113 (HRAS)
   04371 Apelin signaling pathway
    129073113 (HRAS)
   04630 JAK-STAT signaling pathway
    129073113 (HRAS)
   04068 FoxO signaling pathway
    129073113 (HRAS)
   04072 Phospholipase D signaling pathway
    129073113 (HRAS)
   04071 Sphingolipid signaling pathway
    129073113 (HRAS)
   04151 PI3K-Akt signaling pathway
    129073113 (HRAS)
   04150 mTOR signaling pathway
    129073113 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    129073113 (HRAS)
   04140 Autophagy - animal
    129073113 (HRAS)
   04137 Mitophagy - animal
    129073113 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    129073113 (HRAS)
   04218 Cellular senescence
    129073113 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129073113 (HRAS)
   04540 Gap junction
    129073113 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    129073113 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129073113 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    129073113 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    129073113 (HRAS)
   04660 T cell receptor signaling pathway
    129073113 (HRAS)
   04662 B cell receptor signaling pathway
    129073113 (HRAS)
   04664 Fc epsilon RI signaling pathway
    129073113 (HRAS)
   04062 Chemokine signaling pathway
    129073113 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129073113 (HRAS)
   04929 GnRH secretion
    129073113 (HRAS)
   04912 GnRH signaling pathway
    129073113 (HRAS)
   04915 Estrogen signaling pathway
    129073113 (HRAS)
   04917 Prolactin signaling pathway
    129073113 (HRAS)
   04921 Oxytocin signaling pathway
    129073113 (HRAS)
   04926 Relaxin signaling pathway
    129073113 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    129073113 (HRAS)
   04919 Thyroid hormone signaling pathway
    129073113 (HRAS)
   04916 Melanogenesis
    129073113 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    129073113 (HRAS)
   04726 Serotonergic synapse
    129073113 (HRAS)
   04720 Long-term potentiation
    129073113 (HRAS)
   04730 Long-term depression
    129073113 (HRAS)
   04722 Neurotrophin signaling pathway
    129073113 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    129073113 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    129073113 (HRAS)
   04213 Longevity regulating pathway - multiple species
    129073113 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    129073113 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129073113 (HRAS)
   05206 MicroRNAs in cancer
    129073113 (HRAS)
   05205 Proteoglycans in cancer
    129073113 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    129073113 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    129073113 (HRAS)
   05203 Viral carcinogenesis
    129073113 (HRAS)
   05230 Central carbon metabolism in cancer
    129073113 (HRAS)
   05231 Choline metabolism in cancer
    129073113 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129073113 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129073113 (HRAS)
   05225 Hepatocellular carcinoma
    129073113 (HRAS)
   05226 Gastric cancer
    129073113 (HRAS)
   05214 Glioma
    129073113 (HRAS)
   05216 Thyroid cancer
    129073113 (HRAS)
   05221 Acute myeloid leukemia
    129073113 (HRAS)
   05220 Chronic myeloid leukemia
    129073113 (HRAS)
   05218 Melanoma
    129073113 (HRAS)
   05211 Renal cell carcinoma
    129073113 (HRAS)
   05219 Bladder cancer
    129073113 (HRAS)
   05215 Prostate cancer
    129073113 (HRAS)
   05213 Endometrial cancer
    129073113 (HRAS)
   05224 Breast cancer
    129073113 (HRAS)
   05223 Non-small cell lung cancer
    129073113 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129073113 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    129073113 (HRAS)
   05161 Hepatitis B
    129073113 (HRAS)
   05160 Hepatitis C
    129073113 (HRAS)
   05163 Human cytomegalovirus infection
    129073113 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129073113 (HRAS)
   05165 Human papillomavirus infection
    129073113 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129073113 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129073113 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    129073113 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    129073113 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129073113 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    129073113 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129073113 (HRAS)
   01522 Endocrine resistance
    129073113 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppam04131]
    129073113 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppam04147]
    129073113 (HRAS)
   04031 GTP-binding proteins [BR:ppam04031]
    129073113 (HRAS)
Membrane trafficking [BR:ppam04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    129073113 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    129073113 (HRAS)
Exosome [BR:ppam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   129073113 (HRAS)
  Exosomal proteins of colorectal cancer cells
   129073113 (HRAS)
GTP-binding proteins [BR:ppam04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    129073113 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16
Other DBs
NCBI-GeneID: 129073113
NCBI-ProteinID: XP_054432762
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVEARQAQDLARSYGIPYVETSAKTRQGVEDAFYTLVREIRQHKVRKLSPPDEGGPG
CMSCKCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctggtggtggtgggtgctgggggcgtggggaagagcgccctgacc
atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcctac
cggaagcaggtggtcatcgacggggagacgtgtctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggcgagggcttcctctgc
gtgttcgccatcaacaacaccaagtcctttgaggacatccaccagtaccgggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctcgtggggaacaagtgcgacctg
gccgcgcgcacggtggaggctcggcaggcgcaggacctcgcccgcagctacggcatcccc
tacgtcgagacctcggccaagacccgccagggcgtggaggacgcgttctacactctggtg
cgcgagatccggcagcacaaagtgcgcaagctgagcccgccagacgagggcggccccggc
tgcatgagctgcaagtgcctgctctcctga

DBGET integrated database retrieval system