KEGG   Pteronotus mesoamericanus (Parnell's mustached bat): 129078413
Entry
129078413         CDS       T09558                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ppam  Pteronotus mesoamericanus (Parnell's mustached bat)
Pathway
ppam04010  MAPK signaling pathway
ppam04014  Ras signaling pathway
ppam04015  Rap1 signaling pathway
ppam04024  cAMP signaling pathway
ppam04062  Chemokine signaling pathway
ppam04071  Sphingolipid signaling pathway
ppam04145  Phagosome
ppam04148  Efferocytosis
ppam04151  PI3K-Akt signaling pathway
ppam04310  Wnt signaling pathway
ppam04360  Axon guidance
ppam04370  VEGF signaling pathway
ppam04380  Osteoclast differentiation
ppam04510  Focal adhesion
ppam04520  Adherens junction
ppam04530  Tight junction
ppam04613  Neutrophil extracellular trap formation
ppam04620  Toll-like receptor signaling pathway
ppam04650  Natural killer cell mediated cytotoxicity
ppam04662  B cell receptor signaling pathway
ppam04664  Fc epsilon RI signaling pathway
ppam04666  Fc gamma R-mediated phagocytosis
ppam04670  Leukocyte transendothelial migration
ppam04722  Neurotrophin signaling pathway
ppam04810  Regulation of actin cytoskeleton
ppam04932  Non-alcoholic fatty liver disease
ppam04933  AGE-RAGE signaling pathway in diabetic complications
ppam04972  Pancreatic secretion
ppam05014  Amyotrophic lateral sclerosis
ppam05020  Prion disease
ppam05022  Pathways of neurodegeneration - multiple diseases
ppam05100  Bacterial invasion of epithelial cells
ppam05132  Salmonella infection
ppam05135  Yersinia infection
ppam05163  Human cytomegalovirus infection
ppam05167  Kaposi sarcoma-associated herpesvirus infection
ppam05169  Epstein-Barr virus infection
ppam05170  Human immunodeficiency virus 1 infection
ppam05200  Pathways in cancer
ppam05203  Viral carcinogenesis
ppam05205  Proteoglycans in cancer
ppam05208  Chemical carcinogenesis - reactive oxygen species
ppam05210  Colorectal cancer
ppam05211  Renal cell carcinoma
ppam05212  Pancreatic cancer
ppam05231  Choline metabolism in cancer
ppam05415  Diabetic cardiomyopathy
ppam05416  Viral myocarditis
ppam05417  Lipid and atherosclerosis
ppam05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129078413
   04014 Ras signaling pathway
    129078413
   04015 Rap1 signaling pathway
    129078413
   04310 Wnt signaling pathway
    129078413
   04370 VEGF signaling pathway
    129078413
   04071 Sphingolipid signaling pathway
    129078413
   04024 cAMP signaling pathway
    129078413
   04151 PI3K-Akt signaling pathway
    129078413
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    129078413
   04148 Efferocytosis
    129078413
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129078413
   04520 Adherens junction
    129078413
   04530 Tight junction
    129078413
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129078413
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    129078413
   04620 Toll-like receptor signaling pathway
    129078413
   04650 Natural killer cell mediated cytotoxicity
    129078413
   04662 B cell receptor signaling pathway
    129078413
   04664 Fc epsilon RI signaling pathway
    129078413
   04666 Fc gamma R-mediated phagocytosis
    129078413
   04670 Leukocyte transendothelial migration
    129078413
   04062 Chemokine signaling pathway
    129078413
  09154 Digestive system
   04972 Pancreatic secretion
    129078413
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    129078413
  09158 Development and regeneration
   04360 Axon guidance
    129078413
   04380 Osteoclast differentiation
    129078413
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129078413
   05205 Proteoglycans in cancer
    129078413
   05208 Chemical carcinogenesis - reactive oxygen species
    129078413
   05203 Viral carcinogenesis
    129078413
   05231 Choline metabolism in cancer
    129078413
  09162 Cancer: specific types
   05210 Colorectal cancer
    129078413
   05212 Pancreatic cancer
    129078413
   05211 Renal cell carcinoma
    129078413
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    129078413
   05163 Human cytomegalovirus infection
    129078413
   05167 Kaposi sarcoma-associated herpesvirus infection
    129078413
   05169 Epstein-Barr virus infection
    129078413
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129078413
   05135 Yersinia infection
    129078413
   05100 Bacterial invasion of epithelial cells
    129078413
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    129078413
   05020 Prion disease
    129078413
   05022 Pathways of neurodegeneration - multiple diseases
    129078413
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129078413
   05418 Fluid shear stress and atherosclerosis
    129078413
   05415 Diabetic cardiomyopathy
    129078413
   05416 Viral myocarditis
    129078413
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    129078413
   04933 AGE-RAGE signaling pathway in diabetic complications
    129078413
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppam04131]
    129078413
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppam04147]
    129078413
   04031 GTP-binding proteins [BR:ppam04031]
    129078413
Membrane trafficking [BR:ppam04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    129078413
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    129078413
  Macropinocytosis
   Ras GTPases
    129078413
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    129078413
Exosome [BR:ppam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129078413
  Exosomal proteins of other body fluids (saliva and urine)
   129078413
  Exosomal proteins of colorectal cancer cells
   129078413
  Exosomal proteins of bladder cancer cells
   129078413
GTP-binding proteins [BR:ppam04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    129078413
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 129078413
NCBI-ProteinID: XP_054439231
LinkDB
Position
Unknown
AA seq 192 aa
MQALKCVVVGDGAAGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSFPQTDVFLICSSLVSPASFENVHAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKPTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEALRAILCPP
PVKKKKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccctcaagtgtgtggtggtgggagacggcgctgcaggtaaaacctgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatactgcggga
caagaagattatgacagattacgtcccctatcctttccgcagacagacgtgttcttaatt
tgctcttctcttgtgagtcctgcatcatttgaaaatgttcatgcaaagtggtatcctgaa
gtgcgacaccattgtcccaacactcccatcatcctggtggggaccaagcttgatctcagg
gatgacaaagacacgattgagaagctgaaggaaaagaaaccgacacccatcacctaccca
cagggtttagccatggctaaggagatcggtgctgtgaaatacctggagtgctcggctcta
acacagcgaggcctcaagacagtgttcgacgaagctcttcgagccattctctgcccacca
cccgtcaagaagaagaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system