KEGG   Pteronotus mesoamericanus (Parnell's mustached bat): 129084580
Entry
129084580         CDS       T09558                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
ppam  Pteronotus mesoamericanus (Parnell's mustached bat)
Pathway
ppam04014  Ras signaling pathway
ppam04015  Rap1 signaling pathway
ppam04020  Calcium signaling pathway
ppam04022  cGMP-PKG signaling pathway
ppam04024  cAMP signaling pathway
ppam04070  Phosphatidylinositol signaling system
ppam04114  Oocyte meiosis
ppam04218  Cellular senescence
ppam04261  Adrenergic signaling in cardiomyocytes
ppam04270  Vascular smooth muscle contraction
ppam04371  Apelin signaling pathway
ppam04625  C-type lectin receptor signaling pathway
ppam04713  Circadian entrainment
ppam04720  Long-term potentiation
ppam04722  Neurotrophin signaling pathway
ppam04728  Dopaminergic synapse
ppam04740  Olfactory transduction
ppam04744  Phototransduction
ppam04750  Inflammatory mediator regulation of TRP channels
ppam04910  Insulin signaling pathway
ppam04912  GnRH signaling pathway
ppam04915  Estrogen signaling pathway
ppam04916  Melanogenesis
ppam04921  Oxytocin signaling pathway
ppam04922  Glucagon signaling pathway
ppam04924  Renin secretion
ppam04925  Aldosterone synthesis and secretion
ppam04970  Salivary secretion
ppam04971  Gastric acid secretion
ppam05010  Alzheimer disease
ppam05012  Parkinson disease
ppam05022  Pathways of neurodegeneration - multiple diseases
ppam05031  Amphetamine addiction
ppam05034  Alcoholism
ppam05133  Pertussis
ppam05152  Tuberculosis
ppam05163  Human cytomegalovirus infection
ppam05167  Kaposi sarcoma-associated herpesvirus infection
ppam05170  Human immunodeficiency virus 1 infection
ppam05200  Pathways in cancer
ppam05214  Glioma
ppam05417  Lipid and atherosclerosis
ppam05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    129084580
   04015 Rap1 signaling pathway
    129084580
   04371 Apelin signaling pathway
    129084580
   04020 Calcium signaling pathway
    129084580
   04070 Phosphatidylinositol signaling system
    129084580
   04024 cAMP signaling pathway
    129084580
   04022 cGMP-PKG signaling pathway
    129084580
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    129084580
   04218 Cellular senescence
    129084580
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    129084580
  09152 Endocrine system
   04910 Insulin signaling pathway
    129084580
   04922 Glucagon signaling pathway
    129084580
   04912 GnRH signaling pathway
    129084580
   04915 Estrogen signaling pathway
    129084580
   04921 Oxytocin signaling pathway
    129084580
   04916 Melanogenesis
    129084580
   04924 Renin secretion
    129084580
   04925 Aldosterone synthesis and secretion
    129084580
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129084580
   04270 Vascular smooth muscle contraction
    129084580
  09154 Digestive system
   04970 Salivary secretion
    129084580
   04971 Gastric acid secretion
    129084580
  09156 Nervous system
   04728 Dopaminergic synapse
    129084580
   04720 Long-term potentiation
    129084580
   04722 Neurotrophin signaling pathway
    129084580
  09157 Sensory system
   04744 Phototransduction
    129084580
   04740 Olfactory transduction
    129084580
   04750 Inflammatory mediator regulation of TRP channels
    129084580
  09159 Environmental adaptation
   04713 Circadian entrainment
    129084580
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129084580
  09162 Cancer: specific types
   05214 Glioma
    129084580
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    129084580
   05163 Human cytomegalovirus infection
    129084580
   05167 Kaposi sarcoma-associated herpesvirus infection
    129084580
  09171 Infectious disease: bacterial
   05133 Pertussis
    129084580
   05152 Tuberculosis
    129084580
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129084580
   05012 Parkinson disease
    129084580
   05022 Pathways of neurodegeneration - multiple diseases
    129084580
  09165 Substance dependence
   05031 Amphetamine addiction
    129084580
   05034 Alcoholism
    129084580
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129084580
   05418 Fluid shear stress and atherosclerosis
    129084580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppam01009]
    129084580
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppam04131]
    129084580
   03036 Chromosome and associated proteins [BR:ppam03036]
    129084580
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppam04147]
    129084580
Protein phosphatases and associated proteins [BR:ppam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     129084580
Membrane trafficking [BR:ppam04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    129084580
Chromosome and associated proteins [BR:ppam03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     129084580
Exosome [BR:ppam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   129084580
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg Dockerin_1 EF-hand_EFHB_C EF-hand_STIM1 SAPC2_N Temptin_C UPF0154 EF-hand_11 DUF5580_M SurA_N_3 WEF-hand SurA_N_2
Other DBs
NCBI-GeneID: 129084580
NCBI-ProteinID: XP_054446763
LinkDB
Position
Unknown
AA seq 149 aa
MAEELSKEQVAEFKAAFTRFDKNGDGTINVQELGDVLRTLGQNPTEDELKNIIAQVDTDG
DGAISFPEFLAAMAKRMKSLGGQLDLQEVFRAFDLDGDGYITIDELKQAMARVGQKLSQE
ELEAMIKEADLDKDGRVNYEEFSRILNQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagaggagctgtccaaagagcaggtggctgagttcaaggcagccttcaccaggttc
gacaagaacggagatggcactatcaatgtgcaggagctgggtgatgtcctgaggaccctg
ggccagaacccgacagaggatgagctgaagaatatcatcgcccaggtggacacggatggt
gacggtgccatcagtttcccggagttcctggcagcgatggctaagaggatgaagtccttg
ggtggtcagctggacctgcaggaggtgttccgagccttcgacctggacggcgacggctac
atcaccattgacgagctcaagcaggccatggcccgggtggggcagaagctctcccaggag
gagctggaagccatgatcaaggaggcggacctggacaaggatggacgggtgaactacgag
gagttctcgcgcatcctcaaccagaagtga

DBGET integrated database retrieval system