KEGG   Pteronotus mesoamericanus (Parnell's mustached bat): 129086248
Entry
129086248         CDS       T09558                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppam  Pteronotus mesoamericanus (Parnell's mustached bat)
Pathway
ppam01521  EGFR tyrosine kinase inhibitor resistance
ppam01522  Endocrine resistance
ppam01524  Platinum drug resistance
ppam04010  MAPK signaling pathway
ppam04012  ErbB signaling pathway
ppam04014  Ras signaling pathway
ppam04015  Rap1 signaling pathway
ppam04022  cGMP-PKG signaling pathway
ppam04024  cAMP signaling pathway
ppam04062  Chemokine signaling pathway
ppam04066  HIF-1 signaling pathway
ppam04068  FoxO signaling pathway
ppam04071  Sphingolipid signaling pathway
ppam04072  Phospholipase D signaling pathway
ppam04114  Oocyte meiosis
ppam04140  Autophagy - animal
ppam04148  Efferocytosis
ppam04150  mTOR signaling pathway
ppam04151  PI3K-Akt signaling pathway
ppam04210  Apoptosis
ppam04218  Cellular senescence
ppam04261  Adrenergic signaling in cardiomyocytes
ppam04270  Vascular smooth muscle contraction
ppam04350  TGF-beta signaling pathway
ppam04360  Axon guidance
ppam04370  VEGF signaling pathway
ppam04371  Apelin signaling pathway
ppam04380  Osteoclast differentiation
ppam04510  Focal adhesion
ppam04520  Adherens junction
ppam04540  Gap junction
ppam04550  Signaling pathways regulating pluripotency of stem cells
ppam04611  Platelet activation
ppam04613  Neutrophil extracellular trap formation
ppam04620  Toll-like receptor signaling pathway
ppam04621  NOD-like receptor signaling pathway
ppam04625  C-type lectin receptor signaling pathway
ppam04650  Natural killer cell mediated cytotoxicity
ppam04657  IL-17 signaling pathway
ppam04658  Th1 and Th2 cell differentiation
ppam04659  Th17 cell differentiation
ppam04660  T cell receptor signaling pathway
ppam04662  B cell receptor signaling pathway
ppam04664  Fc epsilon RI signaling pathway
ppam04666  Fc gamma R-mediated phagocytosis
ppam04668  TNF signaling pathway
ppam04713  Circadian entrainment
ppam04720  Long-term potentiation
ppam04722  Neurotrophin signaling pathway
ppam04723  Retrograde endocannabinoid signaling
ppam04724  Glutamatergic synapse
ppam04725  Cholinergic synapse
ppam04726  Serotonergic synapse
ppam04730  Long-term depression
ppam04810  Regulation of actin cytoskeleton
ppam04910  Insulin signaling pathway
ppam04912  GnRH signaling pathway
ppam04914  Progesterone-mediated oocyte maturation
ppam04915  Estrogen signaling pathway
ppam04916  Melanogenesis
ppam04917  Prolactin signaling pathway
ppam04919  Thyroid hormone signaling pathway
ppam04921  Oxytocin signaling pathway
ppam04926  Relaxin signaling pathway
ppam04928  Parathyroid hormone synthesis, secretion and action
ppam04929  GnRH secretion
ppam04930  Type II diabetes mellitus
ppam04933  AGE-RAGE signaling pathway in diabetic complications
ppam04934  Cushing syndrome
ppam04935  Growth hormone synthesis, secretion and action
ppam04960  Aldosterone-regulated sodium reabsorption
ppam05010  Alzheimer disease
ppam05020  Prion disease
ppam05022  Pathways of neurodegeneration - multiple diseases
ppam05034  Alcoholism
ppam05132  Salmonella infection
ppam05133  Pertussis
ppam05135  Yersinia infection
ppam05140  Leishmaniasis
ppam05142  Chagas disease
ppam05145  Toxoplasmosis
ppam05152  Tuberculosis
ppam05160  Hepatitis C
ppam05161  Hepatitis B
ppam05163  Human cytomegalovirus infection
ppam05164  Influenza A
ppam05165  Human papillomavirus infection
ppam05166  Human T-cell leukemia virus 1 infection
ppam05167  Kaposi sarcoma-associated herpesvirus infection
ppam05170  Human immunodeficiency virus 1 infection
ppam05171  Coronavirus disease - COVID-19
ppam05200  Pathways in cancer
ppam05203  Viral carcinogenesis
ppam05205  Proteoglycans in cancer
ppam05206  MicroRNAs in cancer
ppam05207  Chemical carcinogenesis - receptor activation
ppam05208  Chemical carcinogenesis - reactive oxygen species
ppam05210  Colorectal cancer
ppam05211  Renal cell carcinoma
ppam05212  Pancreatic cancer
ppam05213  Endometrial cancer
ppam05214  Glioma
ppam05215  Prostate cancer
ppam05216  Thyroid cancer
ppam05218  Melanoma
ppam05219  Bladder cancer
ppam05220  Chronic myeloid leukemia
ppam05221  Acute myeloid leukemia
ppam05223  Non-small cell lung cancer
ppam05224  Breast cancer
ppam05225  Hepatocellular carcinoma
ppam05226  Gastric cancer
ppam05230  Central carbon metabolism in cancer
ppam05231  Choline metabolism in cancer
ppam05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ppam05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129086248 (MAPK1)
   04012 ErbB signaling pathway
    129086248 (MAPK1)
   04014 Ras signaling pathway
    129086248 (MAPK1)
   04015 Rap1 signaling pathway
    129086248 (MAPK1)
   04350 TGF-beta signaling pathway
    129086248 (MAPK1)
   04370 VEGF signaling pathway
    129086248 (MAPK1)
   04371 Apelin signaling pathway
    129086248 (MAPK1)
   04668 TNF signaling pathway
    129086248 (MAPK1)
   04066 HIF-1 signaling pathway
    129086248 (MAPK1)
   04068 FoxO signaling pathway
    129086248 (MAPK1)
   04072 Phospholipase D signaling pathway
    129086248 (MAPK1)
   04071 Sphingolipid signaling pathway
    129086248 (MAPK1)
   04024 cAMP signaling pathway
    129086248 (MAPK1)
   04022 cGMP-PKG signaling pathway
    129086248 (MAPK1)
   04151 PI3K-Akt signaling pathway
    129086248 (MAPK1)
   04150 mTOR signaling pathway
    129086248 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129086248 (MAPK1)
   04148 Efferocytosis
    129086248 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    129086248 (MAPK1)
   04210 Apoptosis
    129086248 (MAPK1)
   04218 Cellular senescence
    129086248 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129086248 (MAPK1)
   04520 Adherens junction
    129086248 (MAPK1)
   04540 Gap junction
    129086248 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    129086248 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129086248 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    129086248 (MAPK1)
   04613 Neutrophil extracellular trap formation
    129086248 (MAPK1)
   04620 Toll-like receptor signaling pathway
    129086248 (MAPK1)
   04621 NOD-like receptor signaling pathway
    129086248 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    129086248 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    129086248 (MAPK1)
   04660 T cell receptor signaling pathway
    129086248 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    129086248 (MAPK1)
   04659 Th17 cell differentiation
    129086248 (MAPK1)
   04657 IL-17 signaling pathway
    129086248 (MAPK1)
   04662 B cell receptor signaling pathway
    129086248 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    129086248 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    129086248 (MAPK1)
   04062 Chemokine signaling pathway
    129086248 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129086248 (MAPK1)
   04929 GnRH secretion
    129086248 (MAPK1)
   04912 GnRH signaling pathway
    129086248 (MAPK1)
   04915 Estrogen signaling pathway
    129086248 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    129086248 (MAPK1)
   04917 Prolactin signaling pathway
    129086248 (MAPK1)
   04921 Oxytocin signaling pathway
    129086248 (MAPK1)
   04926 Relaxin signaling pathway
    129086248 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    129086248 (MAPK1)
   04919 Thyroid hormone signaling pathway
    129086248 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    129086248 (MAPK1)
   04916 Melanogenesis
    129086248 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129086248 (MAPK1)
   04270 Vascular smooth muscle contraction
    129086248 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    129086248 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    129086248 (MAPK1)
   04725 Cholinergic synapse
    129086248 (MAPK1)
   04726 Serotonergic synapse
    129086248 (MAPK1)
   04720 Long-term potentiation
    129086248 (MAPK1)
   04730 Long-term depression
    129086248 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    129086248 (MAPK1)
   04722 Neurotrophin signaling pathway
    129086248 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    129086248 (MAPK1)
   04380 Osteoclast differentiation
    129086248 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    129086248 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129086248 (MAPK1)
   05206 MicroRNAs in cancer
    129086248 (MAPK1)
   05205 Proteoglycans in cancer
    129086248 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    129086248 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    129086248 (MAPK1)
   05203 Viral carcinogenesis
    129086248 (MAPK1)
   05230 Central carbon metabolism in cancer
    129086248 (MAPK1)
   05231 Choline metabolism in cancer
    129086248 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129086248 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129086248 (MAPK1)
   05212 Pancreatic cancer
    129086248 (MAPK1)
   05225 Hepatocellular carcinoma
    129086248 (MAPK1)
   05226 Gastric cancer
    129086248 (MAPK1)
   05214 Glioma
    129086248 (MAPK1)
   05216 Thyroid cancer
    129086248 (MAPK1)
   05221 Acute myeloid leukemia
    129086248 (MAPK1)
   05220 Chronic myeloid leukemia
    129086248 (MAPK1)
   05218 Melanoma
    129086248 (MAPK1)
   05211 Renal cell carcinoma
    129086248 (MAPK1)
   05219 Bladder cancer
    129086248 (MAPK1)
   05215 Prostate cancer
    129086248 (MAPK1)
   05213 Endometrial cancer
    129086248 (MAPK1)
   05224 Breast cancer
    129086248 (MAPK1)
   05223 Non-small cell lung cancer
    129086248 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129086248 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    129086248 (MAPK1)
   05161 Hepatitis B
    129086248 (MAPK1)
   05160 Hepatitis C
    129086248 (MAPK1)
   05171 Coronavirus disease - COVID-19
    129086248 (MAPK1)
   05164 Influenza A
    129086248 (MAPK1)
   05163 Human cytomegalovirus infection
    129086248 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129086248 (MAPK1)
   05165 Human papillomavirus infection
    129086248 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129086248 (MAPK1)
   05135 Yersinia infection
    129086248 (MAPK1)
   05133 Pertussis
    129086248 (MAPK1)
   05152 Tuberculosis
    129086248 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    129086248 (MAPK1)
   05140 Leishmaniasis
    129086248 (MAPK1)
   05142 Chagas disease
    129086248 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129086248 (MAPK1)
   05020 Prion disease
    129086248 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    129086248 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    129086248 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129086248 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    129086248 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    129086248 (MAPK1)
   04934 Cushing syndrome
    129086248 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129086248 (MAPK1)
   01524 Platinum drug resistance
    129086248 (MAPK1)
   01522 Endocrine resistance
    129086248 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppam01001]
    129086248 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ppam03036]
    129086248 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppam04147]
    129086248 (MAPK1)
Enzymes [BR:ppam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     129086248 (MAPK1)
Protein kinases [BR:ppam01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   129086248 (MAPK1)
Chromosome and associated proteins [BR:ppam03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     129086248 (MAPK1)
Exosome [BR:ppam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129086248 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 129086248
NCBI-ProteinID: XP_054448707
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcttacattggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgcgtagccatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacac
gagaacatcattggtatcaatgatatcattagagctccaaccatcgagcaaatgaaagat
gtgtatatagtacaagacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttgaaatatatc
cattcagcaaacgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgattttggcttggcccgcgttgcagatccagaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctctccaacagacccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgcataatcaatttaaaagct
agaaactatctgctttctctcccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaaa
aggattgaagtagaacaggctctggcccacccatatctggagcagtattatgatccaagt
gatgagcccatcgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gagaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system