Paracoccus pantotrophus: ESD82_04295 Help Entry ESD82_04295       CDS       T06495                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppan  Paracoccus pantotrophus Pathway ppan01100   Metabolic pathways ppan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ESD82_04295    00074 Mycolic acid biosynthesis     ESD82_04295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ESD82_04295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QFG35409 UniProt:  A0A1I5L0R9 LinkDB All DBs Position 2:892582..892842 Genome browser AA seq 86 aa AA seqDB search MTEIRDRIIQIIAEQAMLDPSELQLEMSPQEIGIDSLGLVESIFAIEEAFDISVPFNANE PEKSDFDISSLGAIIGAVEKLVADKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacagaaatccgcgaccgcatcatccagatcatcgcagaacaggcgatgctggatcct tccgaactgcagctcgagatgtcgccgcaagagatcggcatcgacagcctgggcctggtc gaatccatctttgccatcgaggaagccttcgacatctcggtgcccttcaacgccaacgag cccgagaaatccgacttcgacatctcgagcctcggcgccatcatcggcgccgtggaaaag ctggttgctgacaaggcatga

DBGET integrated database retrieval system