KEGG   Paracoccus pantotrophus: ESD82_05975
Entry
ESD82_05975       CDS       T06495                                 
Name
(GenBank) AAA family ATPase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
ppan  Paracoccus pantotrophus
Pathway
ppan03420  Nucleotide excision repair
ppan03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    ESD82_05975
   03430 Mismatch repair
    ESD82_05975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppan03400]
    ESD82_05975
Enzymes [BR:ppan01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     ESD82_05975
DNA repair and recombination proteins [BR:ppan03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     ESD82_05975
   MMR (mismatch excision repair)
    Other MMR factors
     ESD82_05975
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 AAA_30 UvrD_C_2 PcrA_UvrD_tudor CarD_TRCF_RID DUF7742 AAA_11 DEAD
Other DBs
NCBI-ProteinID: QFG35703
UniProt: A0AAE6NVI6
LinkDB
Position
2:complement(1231215..1233629)
AA seq 804 aa
MSNFDDSDAFEAAAAPVPLSQRAMGARPAPYLDGLNPAQRAAVEALDGPVLLLAGAGTGK
TRALTTRIAHLLNLGRARPGQILAVTFTNKAAREMKDRVGRLLGEMVEGMPWLGTFHSIS
VKILRRHAELIGDGELHLKPSFTILDTDDQIRLLKQLIQAENIDEKRWPARQLAHLIDGW
KNRCLSPAKLPKGEERAFDGWGGRLYAAYQRRLLELNAVDFGDLLMHCVNLFQAHPDVLR
TWQDRFRYILVDEYQDTNVAQYMWLRLLASGHRNICCVGDDDQSIYGWRGAEVGNILRFE
SDFPGAQVIRLEQNYRSTPHILAAASGLIAANKGRLGKTLWTEAEEGERVRLIGHWDSEA
EARWIGEEIEAFHGGHRHSIGRRSLNDIAILVRASHQMRAFEDRFMTIGLPYRVIGGPRF
YERAEIRDAMAYFRLAVSPTDDLAFERIVNVPKRGLGDKAVQKIQIEARERGLSLLEGAA
SAVATGALGGKGAGALRQFTEAMGRWHADALDASVNHVELAERILDESGYTAMWQNDKSP
DAPGRLDNLKELMKALEEFENLQGFLEHVALVMDNDKGEQSEEVSIMTLHAAKGLEYPIV
FLPGWEDGLFPSQRSMDESGMKGLEEERRLAYVGITRGEELVTISFAGNRRMYGQWQSSL
PSRFIDELPEDHVEVLTPPGLYGGGYGAAAQSFGQPFAQSVMHERAARADVYNSPGWKRM
QERSAQRAQPVHRTPVVIDAEPAARFSVGDRVFHQKFGNGTIMGIAEDTLTIQFPTGFKT
VKAGYVQPASQPAQGGGALDDVPF
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagcaatttcgacgactcggacgctttcgaggccgcagccgccccggtgccgctttcc
cagcgtgccatgggcgcgcggccggcgccctatctggacgggctgaacccggcgcagcgc
gccgcggtcgaggcgctggacgggccggtgctgctgctggccggcgccggcaccggcaag
acccgcgccctgaccacgcgcatcgcgcatctgctgaatctcggccgcgcgcgaccgggg
cagatcctggccgtgaccttcaccaacaaggccgcgcgcgagatgaaggaccgcgtcggc
cggcttctgggcgagatggtcgagggcatgccctggctcggcaccttccactcgatcagc
gtcaagatcctgcgccgccatgctgaactgatcggcgacggcgagttgcacctgaagccc
agcttcaccatcctggacaccgacgaccagatccggctgctgaagcaactgatccaggcc
gagaatatcgacgaaaagcgttggccggcgcggcagctggcgcatctgatcgacggctgg
aagaaccgctgcctgtccccggcaaagctgcccaagggcgaggaacgcgccttcgacggc
tggggcgggcggctttacgccgcctatcagcgccggctgctggaactgaacgcggtcgat
ttcggcgacctgctgatgcattgcgtcaacctgttccaggcgcatcccgacgtgctgcgg
acctggcaggaccgtttccgctatatcctcgtggacgaataccaggacaccaacgtcgcg
caatacatgtggctgcggctgctggcgtccgggcatcgcaacatctgctgcgtgggcgac
gacgaccagtcgatctatggctggcgcggcgccgaggtcggcaatatcctgcgcttcgaa
agcgatttccccggcgcgcaggtgatccggctggaacagaactatcgctcgaccccgcat
atcctcgccgccgcctccgggctgatcgcggcgaacaagggccggctcggcaagacgctg
tggaccgaggccgaggagggcgagcgcgtccgcctgatcggccattgggacagcgaggcc
gaggcgcgctggatcggcgaggagatcgaggccttccacggcgggcatcgccacagcatc
ggccggcgcagcctgaacgacatcgccatcctcgtgcgcgccagccaccagatgcgggcc
ttcgaggaccgcttcatgactatcggcctgccctatcgggtgatcggcggtccgcgcttc
tacgagcgggccgagatccgcgacgccatggcctatttccggctggcggtcagccccacc
gacgacctggccttcgagcgcatcgtgaacgtgcccaagcgcggcttgggcgacaaggcg
gtgcagaagatccagatcgaggcgcgggaacgcggcctgtcgctcttggaaggcgccgcc
tcggccgtcgccaccggcgcgcttggcggcaagggggcaggggcgctgcggcagttcacc
gaggcgatgggccgctggcatgccgatgcgctggacgcctcggtgaaccatgtcgagctg
gccgagcgcatcctggacgaatccggctataccgcgatgtggcagaacgacaagtcgccc
gacgcgccggggcggctggacaacctgaaggaattgatgaaggcgctggaggaattcgaa
aacctccagggtttcctcgagcatgtcgcgctggtcatggacaatgacaagggcgagcag
tccgaggaggtcagcatcatgacccttcacgccgccaaggggctggaataccccatcgtc
ttcctgcccggatgggaggacgggctgttccccagccagcgcagcatggacgaaagcggc
atgaaggggctcgaggaggagcggcgcctggcctatgtcggcatcacccgcggcgaggag
ctggtgacgatcagcttcgccggcaaccgccgcatgtatgggcaatggcagtcctcgctg
ccctcgcgcttcatcgacgaactgcccgaggatcatgtcgaggtgctgacgccgcccggc
ctttacggcggcggctatggcgcggcggcgcagtccttcgggcagcccttcgcgcaatcg
gtgatgcacgaacgcgcggcgcgggcggatgtctacaattcgcccggctggaaacgcatg
caggaacgctccgcccagcgggcccagcccgtccaccgcaccccggtagtgatcgacgcc
gagccggcggcgcggttttcggtgggcgaccgggtgtttcaccagaaattcggcaatggc
acgatcatgggcattgccgaggacacgctgaccatccagttccccaccggtttcaagacg
gtgaaggcgggctatgtgcagcccgcctcgcagcccgcccaggggggcggcgcactggac
gacgtgccgttctaa

DBGET integrated database retrieval system