Pseudomonas phytophila: K3169_03005 Help Entry K3169_03005       CDS       T09747                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppao  Pseudomonas phytophila Pathway ppao00998   Biosynthesis of various antibiotics ppao01100   Metabolic pathways ppao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3169_03005    00074 Mycolic acid biosynthesis     K3169_03005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3169_03005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  UXZ96898 UniProt:  A0ABY6FG47 LinkDB All DBs Position complement(686836..687090) Genome browser AA seq 84 aa AA seqDB search MQTREDIFEILRDALVELFELEPERVTLQANLYQDLEIDSIDAVDLIDHIKRKTGTKIAA EEFKAVRTVNDVVEAVYRLANTAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgaagacatcttcgaaatcctgcgcgatgcgctggtagagctgttcgaa cttgagcctgagcgagtcactctgcaagccaatctttatcaggatctggaaattgacagc attgacgccgtggacctgatcgaccacatcaaacgcaagaccggcaccaaaatcgctgcc gaagagttcaaggcggtgcgcaccgtcaacgatgtcgtcgaggcggtttaccgtctagcc aacaccgcagcatga

DBGET integrated database retrieval system