Pseudomonas phytophila: K3169_03010 Help Entry K3169_03010       CDS       T09747                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppao  Pseudomonas phytophila Pathway ppao00998   Biosynthesis of various antibiotics ppao01100   Metabolic pathways ppao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K3169_03010    00074 Mycolic acid biosynthesis     K3169_03010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K3169_03010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UXZ96899 LinkDB All DBs Position complement(687100..687360) Genome browser AA seq 86 aa AA seqDB search MSVLHQDIKQLIIDALGLEDISTHDIGNDQILFGEGLGLDSVDALELGLAIQKRYGIKID ADAKDTRDHFTSVDSLAAFVSARQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgttctacatcaagacattaagcagttgatcatcgacgccctgggcctcgaagac atcagcactcacgacattggcaacgaccagatcctctttggtgaggggctgggtcttgat tccgtagatgccctggaactggggctggcgatccagaagcgttacggcatcaagatcgat gcggacgccaaagacacccgtgaccatttcaccagcgtcgacagccttgcggcctttgtc agcgcacgacaagcggcctga

DBGET integrated database retrieval system