Pseudomonas phytophila: K3169_23170
Help
Entry
K3169_23170 CDS
T09747
Name
(GenBank) collagen-like protein
Organism
ppao
Pseudomonas phytophila
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
UXZ95207
UniProt:
A0ABY6FBF5
LinkDB
All DBs
Position
complement(5157037..5157795)
Genome browser
AA seq
252 aa
AA seq
DB search
MRKLCLLAAFCSPWAMAQTITVESHSLMRLPSQTSVLQLERLEVADYGTLLIPSGLTEVK
VDQLVLGHEARIAIVPSSQALNLVVRQGELGTGSQITARGAPGTYEKPPLPGRNLNLRVE
HLQGEELFVDARGGAGSPGYVGLDGANGQAPGCVVGSAGRGYNGDNGGNGHDGAAGAQVR
LELPRDFPVERIKVDVQGGAGGLAGAGGKPGKGGASKGCFVYRADGGKAGRAGDAGQPGA
AGPAGALTLQRL
NT seq
759 nt
NT seq
+upstream
nt +downstream
nt
atgcgtaagctttgtttgctggctgccttttgcagcccttgggccatggctcagaccatc
actgtcgaatcgcattcactgatgcgtctgccaagccagaccagcgtgttgcaacttgag
cgcctggaagtggcggattacggcaccttgctgattccgtccgggctgactgaggtgaaa
gtcgatcaactggtgttgggccacgaagcgcgcatcgccattgtacccagcagccaggcg
ctcaatctggtggtccgccagggtgagctgggcacgggcagccagattactgctcgcggc
gcaccgggtacttatgaaaagcctccattaccgggtcgtaacctgaacttgcgcgtcgag
catttgcagggcgaagaactattcgtcgatgcccggggcggtgccggttcgccgggatat
gtcggcctggatggagcaaatggtcaagcgccggggtgtgtagtgggcagcgctggacgc
ggttacaacggcgataacggcggcaatggccacgacggcgcggccggtgcgcaggtgcgt
cttgaactgccgcgggactttccggttgagcgcatcaaggtggacgttcagggcggagcc
ggtggtttggccggtgccggcggcaagccgggtaaaggtggcgcatccaaaggttgcttc
gtgtatcgggcggatggcggcaaggccggacgcgccggtgacgcgggtcagccgggtgcg
gctggacctgctggtgcgttgacgttgcagcggttgtaa
DBGET
integrated database retrieval system