Phlebotomus papatasi: 129799356 Help Entry 129799356         CDS       T10447                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism ppap  Phlebotomus papatasi Pathway ppap04137   Mitophagy - animal ppap04140   Autophagy - animal ppap04144   Endocytosis ppap04145   Phagosome ppap04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ppap00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129799356    04145 Phagosome     129799356    04140 Autophagy - animal     129799356    04137 Mitophagy - animal     129799356    04148 Efferocytosis     129799356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppap04131]     129799356   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppap04147]     129799356    04031 GTP-binding proteins [BR:ppap04031]     129799356 Membrane trafficking [BR:ppap04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129799356 Exosome [BR:ppap04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129799356   Exosomal proteins of other body fluids (saliva and urine)    129799356   Exosomal proteins of colorectal cancer cells    129799356   Exosomal proteins of bladder cancer cells    129799356 GTP-binding proteins [BR:ppap04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129799356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA ATP_bind_1 RsgA_GTPase cobW SRPRB PduV-EutP nSTAND3 AAA_7 ATPase_2 AAA_16 Motif Other DBs NCBI-GeneID:  129799356 NCBI-ProteinID:  XP_055699148 LinkDB All DBs Position 1:45029800..45045557 Genome browser AA seq 168 aa AA seqDB search MATRKKVLLKVIILGDTSVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVVVDDRMVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKNLDSWRDEFLIQASPRDPEHFPF VVLANKIDLENRAVSSKRADQWCKSKNDIPYFETSAKEGINVDLAFQT NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggccacgaggaagaaagtgctcctgaaagtcatcattttgggtgacacgagcgtggga aagacatccctcatgaatcaatatgtgaataaacgcttctcgaatcagtataaagccaca attggggcggattttctcacaaaggaggtagttgtggatgatcgcatggtgactatgcag atctgggatacagctggtcaggaaagatttcagtctcttggtgttgccttctatcgtggc gccgattgctgtgtgctcgtttttgatgtcacagcacccaacaccttcaagaacctcgac tcctggcgagacgagttcctcattcaggctagccccagggatcccgaacacttcccattc gttgtgctggccaataaaatcgacttagaaaatcgagctgtgtcgagtaagagggcggat cagtggtgcaagtcgaaaaatgacatcccatattttgaaacgtcggccaaggagggtatt aatgtggatttggcgttccaaacttga

DBGET integrated database retrieval system