Phlebotomus papatasi: 129799944 Help Entry 129799944         CDS       T10447                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ppap  Phlebotomus papatasi Pathway ppap04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ppap00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129799944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ppap04121]     129799944    03400 DNA repair and recombination proteins [BR:ppap03400]     129799944 Ubiquitin system [BR:ppap04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129799944    Cul5 complex      129799944 DNA repair and recombination proteins [BR:ppap03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129799944 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 GABP-alpha Motif Other DBs NCBI-GeneID:  129799944 NCBI-ProteinID:  XP_055700221 LinkDB All DBs Position 1:complement(3425469..3432495) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVSELKKMIEGILKIRPRDQQLYNKDNTVMEDDKPLQD YGISIVTAKAQAPAQLGLAIRTETGEFEALEITPYSSPPDLPDVMKNQEAANGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtttttctcatgattcggcgaaagaaaacaacaatttttacagacgccaaagac aacacgacagttagtgaattgaaaaagatgatagaagggattctcaagattcggcctcga gatcagcagctttacaataaagacaacacagtcatggaggatgataagccattgcaagac tatggtatctcaattgttacggctaaggctcaggctccagcacaactgggtctcgcaatt cggacagaaacgggtgaatttgaagcgctggaaataacaccatattcatcaccgccagac cttccggacgtgatgaaaaatcaagaggctgccaatggacaggagcaagttgcttaa

DBGET integrated database retrieval system