Pectobacterium parmentieri RNS 08-42-1A: A8F97_02345 Help Entry A8F97_02345       CDS       T04513                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ppar  Pectobacterium parmentieri RNS 08-42-1A Brite KEGG Orthology (KO) [BR:ppar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppar03032]     A8F97_02345    03036 Chromosome and associated proteins [BR:ppar03036]     A8F97_02345    03400 DNA repair and recombination proteins [BR:ppar03400]     A8F97_02345 DNA replication proteins [BR:ppar03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A8F97_02345 Chromosome and associated proteins [BR:ppar03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A8F97_02345 DNA repair and recombination proteins [BR:ppar03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A8F97_02345 SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AOR57753 UniProt:  A0A0H3I733 LinkDB All DBs Position 555378..555650 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAADADISKAAAGRVLDAIIGSVTESLKEGDDVALVGFGTFSVRERAARTG RNPQTGKEISIPAAKVPGFRAGKTLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcacaattgatcgacaaaattgccgcagatgctgatatttccaaagcggca gcagggcgtgtgttagatgcaattattggttccgttaccgaatccctgaaagaaggggat gatgttgccttagttggttttggtactttctcagtgcgtgaacgtgctgcccgtaccggt cgtaacccgcagacgggtaaggaaatcagtatccctgcggcaaaagtaccaggattccgt gctggtaaaacgctgaaagacgctgttaactga

DBGET integrated database retrieval system