Pectobacterium parmentieri RNS 08-42-1A: A8F97_18600 Help Entry A8F97_18600       CDS       T04513                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppar  Pectobacterium parmentieri RNS 08-42-1A Pathway ppar00998   Biosynthesis of various antibiotics ppar01100   Metabolic pathways ppar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A8F97_18600    00074 Mycolic acid biosynthesis     A8F97_18600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A8F97_18600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOR60885 UniProt:  A0A0H3IBL2 LinkDB All DBs Position complement(4107219..4107485) Genome browser AA seq 88 aa AA seqDB search MESLFIEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLAAFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaagtctatttattgaaatcaaagagatgattattgattctcttaatcttgaagat attagcgttgatgaaatagaaacggacgccccgctttttggcgagggtcttggtctggat tctattgatgcacttgaactggggctagcggttaaaaaccgttatggcgtcgtactttct gctgaaagtgaagaagtgcgccaacacttcttttccgttgctacccttgccgcttttatc aacactcagcgcgccgtaagtgcctga

DBGET integrated database retrieval system