Pectobacterium parvum: LOZ86_13865
Help
Entry
LOZ86_13865 CDS
T07916
Symbol
moaE
Name
(GenBank) molybdopterin synthase catalytic subunit MoaE
KO
K03635
molybdopterin synthase catalytic subunit [EC:
2.8.1.12
]
Organism
ppav
Pectobacterium parvum
Pathway
ppav00790
Folate biosynthesis
ppav01100
Metabolic pathways
ppav01240
Biosynthesis of cofactors
ppav04122
Sulfur relay system
Module
ppav_M00880
Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:
ppav00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00790 Folate biosynthesis
LOZ86_13865 (moaE)
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04122 Sulfur relay system
LOZ86_13865 (moaE)
Enzymes [BR:
ppav01000
]
2. Transferases
2.8 Transferring sulfur-containing groups
2.8.1 Sulfurtransferases
2.8.1.12 molybdopterin synthase
LOZ86_13865 (moaE)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MoaE
Motif
Other DBs
NCBI-ProteinID:
UFK38043
LinkDB
All DBs
Position
complement(3081996..3082448)
Genome browser
AA seq
150 aa
AA seq
DB search
MAETRILVGEENFNVGDEYQWLAQCDEDGAVVTFTGKVRNHNLAKDVSALTLEHYPGMTE
KALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKT
RAPFWKREATPEGERWVESRDSDKQAAQRW
NT seq
453 nt
NT seq
+upstream
nt +downstream
nt
gtggcagagacgcgtattctggtcggcgaagagaacttcaatgtaggcgatgaatatcag
tggctggcgcagtgtgatgaagacggcgcggtggtgacgttcaccggtaaggtgcgtaat
cacaatctggcgaaagacgtcagcgcgttgacgctggaacattaccccggcatgacggaa
aaggcgctggcggagattgtcgaactggcacgtgagcgctgggaactgcctcgtgtaagc
gtgattcatcgggtgggcgcactctatccgggcgatgaaattgtgttcgttggcgtgagt
gccgctcaccgcagcgcggcgtttgatgccgcccagtttattatggattacctgaaaacc
cgcgcgccattctggaagcgcgaagcgacgccggaaggtgaacgctgggtggaatcacgc
gacagtgataagcaggccgcgcagcgctggtag
DBGET
integrated database retrieval system