Phyllobacterium pellucidum: LLE51_010730 Help Entry LLE51_010730      CDS       T11259                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pped  Phyllobacterium pellucidum Pathway pped02024   Quorum sensing pped03018   RNA degradation Brite KEGG Orthology (KO) [BR:pped00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     LLE51_010730 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     LLE51_010730 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pped03019]     LLE51_010730 (hfq)    03036 Chromosome and associated proteins [BR:pped03036]     LLE51_010730 (hfq) Messenger RNA biogenesis [BR:pped03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      LLE51_010730 (hfq) Chromosome and associated proteins [BR:pped03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     LLE51_010730 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  UGY08525 LinkDB All DBs Position 2231964..2232203 Genome browser AA seq 79 aa AA seqDB search MAERSQNLQDLFLNSVRKQKISLTIFLINGVKLTGIVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFEVEESD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggctgaacgatcgcagaatcttcaggatctttttctgaattcagtcagaaaacaaaag atttctctgacaattttcctcatcaatggtgtgaaactgaccggcattgtcacttctttt gacaacttttgcgtgcttttacgccgtgacggccattcgcagctcgtctacaaacatgcg atctcgaccataatgccgagccagcccgtgcaaatgttcgaagttgaagagagcgactga

DBGET integrated database retrieval system