Pseudonocardia petroleophila: H6H00_17120 Help Entry H6H00_17120       CDS       T08626                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppel  Pseudonocardia petroleophila Pathway ppel01100   Metabolic pathways ppel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H6H00_17120    00074 Mycolic acid biosynthesis     H6H00_17120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H6H00_17120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNG49999 UniProt:  A0A7G7MB38 LinkDB All DBs Position complement(3439102..3439344) Genome browser AA seq 80 aa AA seqDB search MADSTEILAGLAEIVEEVAGIDTSEVSADKSFVDDLDIDSLSMVEIAVQAEDKFGVKIPD DQLAELKTVGDAVDYIAKNQ NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggcagacagcaccgagatcctcgccggcctcgccgagatcgtcgaggaggtcgccggc atcgacacctccgaggtctccgccgacaagtccttcgtggacgacctcgacatcgactcg ctgtcgatggtcgagatcgccgtccaggccgaggacaagttcggcgtcaagatcccggac gaccagctggccgagctgaagacggtcggtgacgcggtggactacatcgcgaagaaccag tga

DBGET integrated database retrieval system