Prunus persica (peach): 18766481 Help Entry 18766481          CDS       T03092                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pper  Prunus persica (peach) Pathway pper04145   Phagosome pper04148   Efferocytosis pper04620   Toll-like receptor signaling pathway pper05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pper00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18766481    04148 Efferocytosis     18766481  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18766481  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18766481  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18766481   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18766481    04031 GTP-binding proteins [BR:pper04031]     18766481 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18766481  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18766481   Macropinocytosis    Ras GTPases     18766481  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18766481 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18766481   Exosomal proteins of other body fluids (saliva and urine)    18766481   Exosomal proteins of colorectal cancer cells    18766481   Exosomal proteins of bladder cancer cells    18766481 GTP-binding proteins [BR:pper04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18766481 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  18766481 NCBI-ProteinID:  XP_007200549 UniProt:  M5VXR4 LinkDB All DBs Position G8:17177163..17180562 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWVPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggttcataaagtgtgtcacagttggggacggagcggtgggcaagact tgcatgctcatctcctacaccagcaacactttccctacggattatgtgccaactgtgttt gacaatttcagtgcaaatgtggttgtggacgggagcactgttaatttgggattgtgggat actgctggacaggaagattacaatagattaagaccactgagctaccgtggggcagatgtc ttcctacttgcattctctctcataagtaaggccagctatgaaaatattgccaagaaatgg gttcctgaattgaggcattatgcacctggtgttccaattattcttgttggaactaagctt gatcttcgggatgataagcaattctttgtagatcaccctggtgcagtgccaattaccaca gcccagggagaggaactaaagaagctgattggggctccggtttacatcgagtgtagttca aaaacacagcagaatgtgaaagcagtctttgacgcagccattaaagtggttctccagcca ccaaaacagaagaagaaaaagaagagaaaggcacagaaggcctgttctatattgtga

DBGET integrated database retrieval system