Prunus persica (peach): 18768481 Help Entry 18768481          CDS       T03092                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pper  Prunus persica (peach) Pathway pper03083   Polycomb repressive complex pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18768481    04120 Ubiquitin mediated proteolysis     18768481   09126 Chromosome    03083 Polycomb repressive complex     18768481  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18768481    04121 Ubiquitin system [BR:pper04121]     18768481    03036 Chromosome and associated proteins [BR:pper03036]     18768481 Membrane trafficking [BR:pper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18768481 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      18768481    Cul7 complex      18768481 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18768481   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18768481 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  18768481 NCBI-ProteinID:  XP_007201294 UniProt:  M5VZT5 LinkDB All DBs Position G8:17229997..17231474 Genome browser AA seq 157 aa AA seqDB search MATEKKMITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPNVESHVLAKVIEY CRKHVELAANDENKDTVKEFNDDFVNEIKADQSVLFDTILAANYLNIKSLLDLTCQTVAD MIKGKAPEEIRKTFNIHNDFTPEEEAEIRKENEWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atggccactgagaagaagatgataaccctgaagagcgcggacggcgagattttcgaggtg gaagaggcggtggctctggaatcgcagaccatcaagcatatggcggaggacgactgcgtt gacaatgcaattcctttgcccaacgtcgaaagccatgtcctcgccaaagtcatagagtat tgccggaagcacgttgagcttgcggccaatgacgagaacaaggacaccgtcaaggagttc aacgatgacttcgtcaacgaaattaaggccgaccagagtgttctatttgatacaatcttg gctgcaaactatctgaacatcaagagcctgctggatttgacctgccagactgtggctgac atgatcaagggaaaggcacctgaggagattcgcaagacctttaacatccacaatgatttc actccggaggaagaagcggaaattcgcaaggagaacgaatgggcattcgaatga

DBGET integrated database retrieval system