Prunus persica (peach): 18769239 Help Entry 18769239          CDS       T03092                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pper  Prunus persica (peach) Pathway pper03083   Polycomb repressive complex pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18769239    04120 Ubiquitin mediated proteolysis     18769239   09126 Chromosome    03083 Polycomb repressive complex     18769239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18769239    04121 Ubiquitin system [BR:pper04121]     18769239    03036 Chromosome and associated proteins [BR:pper03036]     18769239 Membrane trafficking [BR:pper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18769239 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      18769239    Cul7 complex      18769239 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18769239   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18769239 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Methyltransf_16 Motif Other DBs NCBI-GeneID:  18769239 NCBI-ProteinID:  XP_007202708 UniProt:  M5VRC8 LinkDB All DBs Position G7:17359430..17361010 Genome browser AA seq 156 aa AA seqDB search MSSSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY CKKHVDAAKPDEKISEDDLKAWDQDFVKVDQATLFDLILAANYLNIKLLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgtcgaagaagatcaccctgaagagctctgatggcgaatcgttcgaggtt gaagaagcggtggctcttgagtcgcagaccatcaagcatatgatcgaggacgattgcgcc gacaacggcattcctctgcccaacgtgacgagcaagatcttggccaaggtcatcgagtac tgcaagaagcacgtcgacgctgccaagcctgatgagaagatctccgaggatgatctcaag gcttgggatcaggactttgtcaaagttgaccaggcaaccctatttgatctcattctggct gcaaactacttgaacatcaagctcctgctggacctgacatgccagactgttgcggacatg atcaaggggaagaccccggaggagatccgaaagaccttcaatatcaagaacgacttcacc ccggaggaggaggaggaagttcgtcgcgagaaccagtgggcatttgaatga

DBGET integrated database retrieval system