Prunus persica (peach): 18770340 Help Entry 18770340          CDS       T03092                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism pper  Prunus persica (peach) Pathway pper04016   MAPK signaling pathway - plant pper04070   Phosphatidylinositol signaling system pper04075   Plant hormone signal transduction pper04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pper00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     18770340    04070 Phosphatidylinositol signaling system     18770340    04075 Plant hormone signal transduction     18770340  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     18770340  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pper01009]     18770340   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18770340    03036 Chromosome and associated proteins [BR:pper03036]     18770340   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18770340 Protein phosphatases and associated proteins [BR:pper01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      18770340 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     18770340 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      18770340 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    18770340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  18770340 NCBI-ProteinID:  XP_020423525 LinkDB All DBs Position G7:complement(3806476..3808945) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctgaccgacgatcagatctctgagttcaaggaagccttcagcctattc gacaaggatggcgatggctgtatcactaccaaggaactcgggactgtgatgagatcattg gggcagaacccaactgaggcagagctccaggacatgattaatgaagtggatgctgatggt aatggaaccatcgactttcctgagttcttaaacctgatggccaggaagatgaaagacacc gactctgaggaggagctgaaagaggctttcagagtttttgataaggatcagaatggcttc atttctgctgctgagctgcgccatgtgatgacaaatctgggggagaagctcactgacgag gaagttgatgagatgattcgtgaggctgatgttgatggtgatggccagataaattacgag gagtttgttaaggtgatgatggctaagtga

DBGET integrated database retrieval system