Prunus persica (peach): 18774027 Help Entry 18774027          CDS       T03092                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism pper  Prunus persica (peach) Pathway pper04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     18774027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pper04121]     18774027    03400 DNA repair and recombination proteins [BR:pper03400]     18774027 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      18774027    Cul5 complex      18774027 DNA repair and recombination proteins [BR:pper03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      18774027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  18774027 NCBI-ProteinID:  XP_007206186 UniProt:  M5WKP2 LinkDB All DBs Position G6:complement(4676797..4678649) Genome browser AA seq 98 aa AA seqDB search MRKEETVKLISAEGFEFVIHKDAAMVSQTIRNMLTSPGSFAETEHGEVTFPEISTTILEK ICKYFYWNLQYASGKQTEFHIEPELVLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaggaaggaagagactgtgaaactaatcagcgccgagggcttcgagttcgtgatccac aaagacgccgccatggtctctcagaccatccgaaacatgctcacttctccagggagtttt gctgaaacggaacacggcgaggtgacgttccctgagatcagcaccaccattcttgagaag atctgcaagtatttttactggaaccttcaatatgcaagtgggaagcagaccgagtttcat attgaacctgaattggttctggagttgatgatggcagccaattatctccatacatga

DBGET integrated database retrieval system