Prunus persica (peach): 18774940 Help Entry 18774940          CDS       T03092                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pper  Prunus persica (peach) Brite KEGG Orthology (KO) [BR:pper00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pper03041]     18774940   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pper04052]     18774940 Spliceosome [BR:pper03041]  Complex B   Other components    Complex B specific factors     18774940 Cytokines and neuropeptides [BR:pper04052]  Neuropeptides   Unclassified    18774940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL HCBP_related Crinkler Motif Other DBs NCBI-GeneID:  18774940 NCBI-ProteinID:  XP_007205080 UniProt:  M5VXX9 LinkDB All DBs Position G6:complement(23718677..23720398) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVKVKCNEDDTIGDLKKLVAAQTGTRSDKIRIQKWYNVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgctgaacgatcgtctcgggaagaaggtgaaagtgaagtgcaacgag gatgacaccataggcgacctcaagaagctcgtggctgctcagacgggtacccgatccgac aagattcggatccagaagtggtacaacgtctacaaggaccacatcaccctcaaggactat gaaatccatgacggcatgggcctcgagctctattacaactaa

DBGET integrated database retrieval system