Prunus persica (peach): 18775964 Help Entry 18775964          CDS       T03092                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pper  Prunus persica (peach) Pathway pper04145   Phagosome pper04148   Efferocytosis pper04517   IgSF CAM signaling pper04518   Integrin signaling pper04620   Toll-like receptor signaling pathway pper05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pper00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     18775964    04518 Integrin signaling     18775964  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18775964    04148 Efferocytosis     18775964  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18775964  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18775964  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18775964   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18775964    04031 GTP-binding proteins [BR:pper04031]     18775964 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18775964  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18775964   Macropinocytosis    Ras GTPases     18775964  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18775964 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18775964   Exosomal proteins of other body fluids (saliva and urine)    18775964   Exosomal proteins of colorectal cancer cells    18775964   Exosomal proteins of bladder cancer cells    18775964 GTP-binding proteins [BR:pper04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18775964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  18775964 NCBI-ProteinID:  XP_007211210 UniProt:  M5WFA6 LinkDB All DBs Position G5:14998093..15001527 Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKQKARQGCLVNILCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaagcgcttcaaggttcataaagtgtgtgacggtgggagatggagctgtgggg aagacctgtatgcttatttgctacaccagcaacaaatttcccacggattatatacccact gtgtttgataacttcagcgctaatgtggtggttgaaggcaccacagtgaacttaggcctc tgggacaccgctgggcaagaggattacaatcgattaaggccattgagctacagaggggca gatgtctttgtcttagctttctcattagttagtcgtgcaagctatgagaacgtgctgaaa aagtggatccctgaactccagcattatgctcccggagtcccagttgtacttgctggcacc aaattagatcttcgagaggataagcactatttggctgatcacccaggattggtacctgtg accactgcacagggcgaggagctgcgcaagcagattggtgcttcattttatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcgatcagggtggttatc aagccaccacagaagcagaaggagaagaagcaaaaggcacgtcaaggatgcctagtcaac atcctttgcggaaggaggctagtgtgtctcaaatga

DBGET integrated database retrieval system