Prunus persica (peach): 18775964 Help Entry 18775964          CDS       T03092                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pper  Prunus persica (peach) Pathway pper04145   Phagosome pper04148   Efferocytosis pper04620   Toll-like receptor signaling pathway pper05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pper00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18775964    04148 Efferocytosis     18775964  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18775964  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18775964  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18775964   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18775964    04031 GTP-binding proteins [BR:pper04031]     18775964 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18775964  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18775964   Macropinocytosis    Ras GTPases     18775964  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18775964 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18775964   Exosomal proteins of other body fluids (saliva and urine)    18775964   Exosomal proteins of colorectal cancer cells    18775964   Exosomal proteins of bladder cancer cells    18775964 GTP-binding proteins [BR:pper04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18775964 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  18775964 NCBI-ProteinID:  XP_007211210 UniProt:  M5WFA6 LinkDB All DBs Position G5:14998093..15001527 Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKQKARQGCLVNILCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaagcgcttcaaggttcataaagtgtgtgacggtgggagatggagctgtgggg aagacctgtatgcttatttgctacaccagcaacaaatttcccacggattatatacccact gtgtttgataacttcagcgctaatgtggtggttgaaggcaccacagtgaacttaggcctc tgggacaccgctgggcaagaggattacaatcgattaaggccattgagctacagaggggca gatgtctttgtcttagctttctcattagttagtcgtgcaagctatgagaacgtgctgaaa aagtggatccctgaactccagcattatgctcccggagtcccagttgtacttgctggcacc aaattagatcttcgagaggataagcactatttggctgatcacccaggattggtacctgtg accactgcacagggcgaggagctgcgcaagcagattggtgcttcattttatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcgatcagggtggttatc aagccaccacagaagcagaaggagaagaagcaaaaggcacgtcaaggatgcctagtcaac atcctttgcggaaggaggctagtgtgtctcaaatga

DBGET integrated database retrieval system