Prunus persica (peach): 18779649 Help Entry 18779649          CDS       T03092                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism pper  Prunus persica (peach) Pathway pper03018   RNA degradation pper03040   Spliceosome Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     18779649   09123 Folding, sorting and degradation    03018 RNA degradation     18779649  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pper03019]     18779649    03041 Spliceosome [BR:pper03041]     18779649 Messenger RNA biogenesis [BR:pper03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      18779649   mRNA degradation factors    5'-3' decay     Lsm complex      18779649 Spliceosome [BR:pper03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     18779649  Complex C   U2 snRNP components     18779649 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX LSM14 DUF150_C Motif Other DBs NCBI-GeneID:  18779649 NCBI-ProteinID:  XP_007212296 UniProt:  M5X346 LinkDB All DBs Position G4:complement(8439877..8442780) Genome browser AA seq 93 aa AA seqDB search MLFFSYFKELVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQEKYPHMLSVRNC FIRGSVVRYVQLPPEGVDVELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtatttcaaggagttggtgggcagagaagtgacagtggagctgaag aatgatcttgcaatcagaggaacactgcactcagtggatcagtacctcaacataaagcta gagaacacaagggtcgtcgaccaagagaagtacccgcacatgttgtcagtgaggaactgt tttattaggggatcagtcgtgagatatgtgcaactacccccagagggagtggacgttgaa ctgctgcatgatgccaccagaagggaagctcgtggtggctga

DBGET integrated database retrieval system