Prunus persica (peach): 18787032 Help Entry 18787032          CDS       T03092                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pper  Prunus persica (peach) Pathway pper03083   Polycomb repressive complex pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18787032    04120 Ubiquitin mediated proteolysis     18787032   09126 Chromosome    03083 Polycomb repressive complex     18787032  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18787032    04121 Ubiquitin system [BR:pper04121]     18787032    03036 Chromosome and associated proteins [BR:pper03036]     18787032 Membrane trafficking [BR:pper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18787032 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      18787032    Cul7 complex      18787032 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18787032   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18787032 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  18787032 NCBI-ProteinID:  XP_007221090 LinkDB All DBs Position G2:15595395..15595954 Genome browser AA seq 156 aa AA seqDB search MASVEMKKITLKSEDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLQNVTSNIVAKVIE YCKKHHEEDADGEKNKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADM INGKTPEEIREIFNIKNDFTPEEEKEVRNENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcctccgttgagatgaagaagataaccctaaagagcgaagacggtgagatctttgag gtggaggaggctgtggccatgcagtcgcagaccatcaggcacatggtggaggacgactgc gccgatggcccaatacctctgcagaacgtgactagcaacatcgtagcgaaggtgatcgag tactgcaagaagcaccatgaagaggatgctgatggcgagaagaacaaagaggacattaag aaatgggatgttgagttcgtgaaggtggaccagagtactatgtttgacttaatcttggct gcaaactatctcaatgtcaagagcctgctggatttgacttgccagactgtggcggacatg atcaatggaaagacacctgaagagattcgtgagatcttcaacatcaaaaatgacttcacg cctgaagaagaaaaggaggttcgtaacgagaaccaatgggcatttgagtga

DBGET integrated database retrieval system