Prunus persica (peach): 18787479 Help Entry 18787479          CDS       T03092                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pper  Prunus persica (peach) Pathway pper03083   Polycomb repressive complex pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18787479    04120 Ubiquitin mediated proteolysis     18787479   09126 Chromosome    03083 Polycomb repressive complex     18787479  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18787479    04121 Ubiquitin system [BR:pper04121]     18787479    03036 Chromosome and associated proteins [BR:pper03036]     18787479 Membrane trafficking [BR:pper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18787479 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      18787479    Cul7 complex      18787479 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18787479   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18787479 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  18787479 NCBI-ProteinID:  XP_007219396 UniProt:  M5XNH0 LinkDB All DBs Position G2:15619878..15620714 Genome browser AA seq 156 aa AA seqDB search MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIKHMVEDDCADGPIPLPNVTSNIVAKVIE YCKKHHEEDADGEKNKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADM INGKTPEEIREIFNIKNDFTPEEEKEVRNENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcctccgttgagatgaagaaaataaccctaaagagcgacgacggtgagatctttgag gtggaggaggctgtggccatgcagtcacagaccatcaagcacatggtggaggacgactgc gccgatggcccaatacctctgccgaacgtgactagcaacatcgtagcgaaggtgatcgag tactgcaagaagcaccatgaagaggatgctgatggcgagaagaacaaagaggacattaag aaatgggatgttgagttcgtgaaggtggaccagagtactatgtttgacttaatcttggct gcaaactatctcaatgtcaagagcctgctggatttgacttgccagactgtggcggacatg atcaatggaaagacacctgaagagattcgtgagatcttcaacatcaaaaatgacttcacg ccagaggaagaaaaggaggttcgtaatgagaaccaatgggcatttgagtga

DBGET integrated database retrieval system