Prunus persica (peach): 18791569 Help Entry 18791569          CDS       T03092                                  Name (RefSeq) 10 kDa chaperonin, mitochondrial   KO K04078   chaperonin GroES Organism pper  Prunus persica (peach) Brite KEGG Orthology (KO) [BR:pper00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pper03110]     18791569    03029 Mitochondrial biogenesis [BR:pper03029]     18791569 Chaperones and folding catalysts [BR:pper03110]  Heat shock proteins   HSP10    18791569 Mitochondrial biogenesis [BR:pper03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     18791569 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  18791569 NCBI-ProteinID:  XP_007223767 UniProt:  M5XHL1 LinkDB All DBs Position G1:31067061..31067976 Genome browser AA seq 97 aa AA seqDB search MARRLIPTLNRVLIEKIIPPSKTTAGILLPESSTKLNSGKVVAVGPGAKDKAGNVIPVAV KEGDTVLLPEYGGTQVKLGDKELHLYRDEDILGTLHE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggctaggcgtttgatcccaaccctcaaccgtgtcctgattgagaaaatcatcccaccc tctaaaaccaccgccggcattctcctccccgagtcatccaccaagctaaactcagggaag gtggttgctgtgggaccaggagccaaggataaggctgggaatgtgattccagtggctgtg aaagaaggtgatacagttcttttgcctgagtatgggggcacccaagtcaagcttggtgac aaagagctccatttatacagggatgaggacatcttgggcactctccatgaatga

DBGET integrated database retrieval system