Prunus persica (peach): 18792458 Help Entry 18792458          CDS       T03092                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pper  Prunus persica (peach) Pathway pper04145   Phagosome pper04148   Efferocytosis pper04620   Toll-like receptor signaling pathway pper05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pper00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18792458    04148 Efferocytosis     18792458  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18792458  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18792458  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18792458   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18792458    04031 GTP-binding proteins [BR:pper04031]     18792458 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18792458  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18792458   Macropinocytosis    Ras GTPases     18792458  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18792458 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18792458   Exosomal proteins of other body fluids (saliva and urine)    18792458   Exosomal proteins of colorectal cancer cells    18792458   Exosomal proteins of bladder cancer cells    18792458 GTP-binding proteins [BR:pper04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18792458 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  18792458 NCBI-ProteinID:  XP_007223496 UniProt:  M5XZG8 LinkDB All DBs Position G1:33366720..33369673 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELQHYAPGVPIILVGTKL DLRDDKQFFIDHSGAVPINTTQGEEMRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKGQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccaggttcataaagtgcgtgacagtcggtgacggtgctgtcggcaaaacc tgcatgcttatttcctacaccagcaacacctttcctacggactacgtgccgaccgttttc gacaatttcagtgctaatgttgttgtggatggaagcactgtcaacttagcactatgggat acagctgggcaggaggattacaatagattaaggcccttgagctatcgaggggcagatgtc tttatcctcgctttttctctcataagcaaagccagctatgaaaatgttgcaaaaaagtgg attcctgaactgcagcattatgcacccggcgttccaataattctggttggaacaaagctt gatcttcgggatgataaacaattttttattgaccattctggtgcagttcccattaatact actcagggagaggaaatgaggaaactaattggagcgccagcatacattgagtgtagctca aaaacacaacagaatgtgaaggctgtttttgatgcggccattaaggttgtgctccagccg ccaaagcaaaagaagaaaaagagaaagggacaaaaggcttgctccatattgtga

DBGET integrated database retrieval system