Prunus persica (peach): 18792458 Help Entry 18792458          CDS       T03092                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pper  Prunus persica (peach) Pathway pper04145   Phagosome pper04148   Efferocytosis pper04517   IgSF CAM signaling pper04518   Integrin signaling pper04620   Toll-like receptor signaling pathway pper05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pper00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     18792458    04518 Integrin signaling     18792458  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18792458    04148 Efferocytosis     18792458  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18792458  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18792458  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18792458   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pper04147]     18792458    04031 GTP-binding proteins [BR:pper04031]     18792458 Membrane trafficking [BR:pper04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18792458  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18792458   Macropinocytosis    Ras GTPases     18792458  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18792458 Exosome [BR:pper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18792458   Exosomal proteins of other body fluids (saliva and urine)    18792458   Exosomal proteins of colorectal cancer cells    18792458   Exosomal proteins of bladder cancer cells    18792458 GTP-binding proteins [BR:pper04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18792458 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  18792458 NCBI-ProteinID:  XP_007223496 UniProt:  M5XZG8 LinkDB All DBs Position G1:33366720..33369673 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELQHYAPGVPIILVGTKL DLRDDKQFFIDHSGAVPINTTQGEEMRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKGQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccaggttcataaagtgcgtgacagtcggtgacggtgctgtcggcaaaacc tgcatgcttatttcctacaccagcaacacctttcctacggactacgtgccgaccgttttc gacaatttcagtgctaatgttgttgtggatggaagcactgtcaacttagcactatgggat acagctgggcaggaggattacaatagattaaggcccttgagctatcgaggggcagatgtc tttatcctcgctttttctctcataagcaaagccagctatgaaaatgttgcaaaaaagtgg attcctgaactgcagcattatgcacccggcgttccaataattctggttggaacaaagctt gatcttcgggatgataaacaattttttattgaccattctggtgcagttcccattaatact actcagggagaggaaatgaggaaactaattggagcgccagcatacattgagtgtagctca aaaacacaacagaatgtgaaggctgtttttgatgcggccattaaggttgtgctccagccg ccaaagcaaaagaagaaaaagagaaagggacaaaaggcttgctccatattgtga

DBGET integrated database retrieval system