Prunus persica (peach): 18792975 Help Entry 18792975          CDS       T03092                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pper  Prunus persica (peach) Pathway pper03083   Polycomb repressive complex pper04120   Ubiquitin mediated proteolysis pper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18792975    04120 Ubiquitin mediated proteolysis     18792975   09126 Chromosome    03083 Polycomb repressive complex     18792975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pper04131]     18792975    04121 Ubiquitin system [BR:pper04121]     18792975    03036 Chromosome and associated proteins [BR:pper03036]     18792975 Membrane trafficking [BR:pper04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     18792975 Ubiquitin system [BR:pper04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      18792975    Cul7 complex      18792975 Chromosome and associated proteins [BR:pper03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      18792975   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      18792975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  18792975 NCBI-ProteinID:  XP_007225985 UniProt:  M5XMN2 LinkDB All DBs Position G1:complement(33286009..33287338) Genome browser AA seq 156 aa AA seqDB search MSSERKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC KKHVDAAKPDDRPSNDEDLKAWDTDFVKIDQATLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcagagaggaagataacactgaaaagctcggacggcgagacgttcgaggtggac gaggcggtggccttggagtctcagacgataaagcacatggtcgaggacgattgtgcggac aatgggatcccacttcccaacgtcaccagcaagatcttggccaaggtcatcgagtactgc aagaagcacgtcgacgctgctaagcccgacgaccgcccttccaacgatgaggacctcaag gcctgggacaccgactttgtcaagatcgaccaggccaccctcttcgatctcatactggct gcaaactatttgaacataaagagcttgctggacctgacttgccaaacggtggcggacatg atcaagggcaaaactcctgaggagattcgcaagacgttcaacattaagaacgactttacg cccgaggaagaggaggaggtccgcagggagaaccaatgggcttttgagtga

DBGET integrated database retrieval system