Pseudomonas putida F1: Pput_3799 Help Entry Pput_3799         CDS       T00537                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppf  Pseudomonas putida F1 Pathway ppf01100   Metabolic pathways ppf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pput_3799    00074 Mycolic acid biosynthesis     Pput_3799   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pput_3799 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Fas_alpha_ACP Ribosomal_L50 DUF1493 HLH DUF6952 Motif Other DBs NCBI-ProteinID:  ABQ79923 UniProt:  A5W713 LinkDB All DBs Position complement(4262178..4262414) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTIEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVKAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaagaagtgactattgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgaactggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaaagcccaccaggcctaa

DBGET integrated database retrieval system