KEGG   Pseudomonas putida GB-1: PputGB1_1851
Entry
PputGB1_1851      CDS       T00650                                 
Name
(GenBank) NADH/Ubiquinone/plastoquinone (complex I)
  KO
K05561  multicomponent K+:H+ antiporter subunit D
Organism
ppg  Pseudomonas putida GB-1
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppg02000]
    PputGB1_1851
Transporters [BR:ppg02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PputGB1_1851
SSDB
Motif
Pfam: Proton_antipo_M NADHdeh_related
Other DBs
NCBI-ProteinID: ABY97754
UniProt: B0KJB5
LinkDB
Position
complement(2078183..2079862)
AA seq 559 aa
MSGMSQLIVAPILLPLITASVMLLLGEKHRHIKARLNLLSTFAGLVIAVSLLLWVRTQGQ
AESIGVYLPGNWPAPFGIVLVVDHLSALLLTLTGVIGFSALLFARARWDGAGASFHALFQ
IQLMGLYGAFLTADLFNLFVFFEVLLAASYGLLLHGSGRARVRAGLHYIAINLFASSLFL
IGAAMLYGVTGTLNMADLALKIPLVPEADRGLLHAGAAILAMAFLVKAGIWPLNFWLVPA
YASASAPVAALFAIMTKVGLYAVLRLWTLLFSGQAGASAHFGGEWLVYGGLVTLAVAAVS
ILAAQRLERMAALSILVSAGTLLGAVGFAQSALTGAALFYLVNSTLALCALFLLAELVER
SRSANEAPLDEEEDAMPPPLESLHPPKGINLDDEQKAVIGQIIPWTMAFLGLSFIACALL
IIGMPPLSGFVAKLNLISALFNPLGLGVPAEQPLSVAGWGLVALLILSGLASLIAFGRVG
IQRFWKPEERPSPVLRRYECLPIVILLGLCIILSLKAEPLLRYTQDTAASLQAPDAYIEA
VMAARPIPGPTTLDVQVQP
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgagtggcatgagtcaactgatcgtcgcccccattctgctgccgctgattactgcatcg
gtgatgttgctgctgggtgaaaagcacaggcatatcaaggccaggctgaacctgctgtca
accttcgccggcctggtcatcgcggtctctctgctgctgtgggtgcggacccagggccag
gcagagtcgataggcgtgtacctgccgggtaactggccggcgccattcggcatcgtgctg
gtggtggaccacttgtctgcgctcttgctgaccctgaccggggtgatcggtttcagtgcg
ctactgtttgcccgtgcccgctgggacggcgccggggccagcttccatgcgctgttccag
atccagctgatgggcctgtacggggccttcctcaccgccgacctgttcaacctgttcgtg
ttcttcgaagtgctgctggccgcctcctatggcctgctgctgcatggctcgggtcgcgct
cgggtgcgcgccggcctgcactacatcgccatcaacctgttcgcctcatcgttgttcctg
atcggcgcagcaatgctgtatggcgtgaccggtaccttgaacatggccgatctggcactg
aagattccactggtaccggaggccgaccgtggcctgctgcatgccggcgcggcaatcctg
gccatggccttcctggtcaaggccggtatctggccgctgaacttctggctggtgccagcc
tacgcctcggccagtgcgccggtggctgcgctgttcgccatcatgaccaaagtcggcctg
tacgccgtgctgcgcctgtggacgctgctgttctccgggcaggccggagcctcggcgcat
ttcggcggcgagtggctggtgtacggcggcctggtcactctggcggtggcagcagtatcg
atccttgccgcacagcgcctggagcgcatggcggccctgagcatactggtctcggccggc
accctgctcggcgccgtcggctttgcccagtcggcgctgaccggcgcggcgttgttctat
ctggtcaattcgaccctcgcgctgtgcgcactgttcctgctcgctgaactggtcgagcgt
tcgcgctcggccaatgaagcaccgctggacgaagaagaagacgccatgcccccaccgctg
gaatcgctgcacccgcccaaaggcatcaacctcgacgatgagcagaaggcggtgatcggc
cagatcatcccgtggaccatggccttccttggcctcagcttcatcgcttgtgcgctgctg
atcatcggcatgccgccgctgtcgggttttgtcgccaagctcaaccttatcagcgcgcta
ttcaacccactgggcctcggcgtgcccgccgaacagccgctgagtgtggccggctggggt
ctcgtggccttgctgatcctctccggtttggcttcgctgatcgccttcggccgcgttggc
atccagcgtttctggaaacccgaagaacggccctcgccggtactgcgccgctatgagtgc
ctgccgatcgtcatcctgctcggcctgtgcatcatactcagcctcaaggccgagccgttg
ctgcgctacacccaggacacagctgccagcctgcaggccccggacgcctatatcgaagcc
gtgatggccgcccggccgattcctggccccaccacgctcgacgtacaggtgcagccatga

DBGET integrated database retrieval system