Pseudomonas putida GB-1: PputGB1_5262 Help Entry PputGB1_5262      CDS       T00650                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism ppg  Pseudomonas putida GB-1 Brite KEGG Orthology (KO) [BR:ppg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppg03036]     PputGB1_5262 Chromosome and associated proteins [BR:ppg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PputGB1_5262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP Filament Asd-4 TPR_MLP1_2 ZapB Motif Other DBs NCBI-ProteinID:  ABZ01145 UniProt:  B0KP87 LinkDB All DBs Position 5881221..5881439 Genome browser AA seq 72 aa AA seqDB search MQPTQENDLQALMSRFELLIERVEQLKRQNALLLAQEKSWREERAHLIEKNEIAKRKVES MILRLKALEQDS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgcaacccacgcaagagaacgacctgcaggcactgatgagccgattcgagttgctgatc gaacgcgtcgagcaactaaaacggcaaaatgcactcctattagcgcaggaaaaatcctgg cgcgaagagcgcgcccacctcatcgaaaaaaacgagatcgccaagcgcaaagtcgagtcg atgattttacgcctcaaggctctggagcaagactcatga

DBGET integrated database retrieval system