Pelodictyon phaeoclathratiforme: Ppha_0196 Help Entry Ppha_0196         CDS       T00731                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pph  Pelodictyon phaeoclathratiforme Pathway pph01100   Metabolic pathways pph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ppha_0196    00074 Mycolic acid biosynthesis     Ppha_0196   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ppha_0196 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ACF42533 UniProt:  B4SBB2 LinkDB All DBs Position complement(193309..193548) Genome browser AA seq 79 aa AA seqDB search MTAAEIKDKVYDIIVSKMGVNRDQIKMESKFSDDLGADSLDTVELIMELESEFGVQIPDE DAEKIGTVQQAIDYIVNKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgactgcagcagaaatcaaagataaggtatacgatattatcgtcagcaagatgggtgtt aacagggatcagatcaaaatggaatcaaaattttctgatgatctcggtgcagattcactt gataccgttgaactgatcatggaacttgaaagcgaattcggcgtacagattcctgatgaa gatgcagagaaaatcggcaccgtccagcaggctatcgattacatcgtcaacaagaagtaa

DBGET integrated database retrieval system