KEGG   Phocoena phocoena (harbor porpoise): 136117929
Entry
136117929         CDS       T11058                                 
Symbol
XRCC3
Name
(RefSeq) DNA repair protein XRCC3
  KO
K10880  DNA-repair protein XRCC3
Organism
pphc  Phocoena phocoena (harbor porpoise)
Pathway
pphc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pphc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    136117929 (XRCC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pphc03400]
    136117929 (XRCC3)
DNA repair and recombination proteins [BR:pphc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     136117929 (XRCC3)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA ATPase DnaB_C
Other DBs
NCBI-GeneID: 136117929
NCBI-ProteinID: XP_065727015
LinkDB
Position
2:1563850..1571737
AA seq 346 aa
MDVDQLDLNPRIIAAVKKVKLRSVKEVLHLSGPDLQRLTRLSGPDVQRLLKAASSHLQGS
SVCTALHLLQQEEQFPEQHERLSLGCPVLDGLLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQLPRRHGGLEAGAVYVCTEDAFPSRRLQQLIAQQQRLRTDVPGDVLRKIRFGHQIF
IEHAADVDTLLECVHKKVPVLLSRGMARLVVIDSVAAPFRCEFDQAASALRARRLQALGA
ELRRLSCIFRSPVLCINQVTESTEERGVAAGPPGVGGERASPALGITWSNQLLVRLTADR
LRPEEATSAPPRRTLRVVSAPHLPPSSCSYTVTAEGVRGTPGTESC
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggatgtggatcagttggacctgaatcccagaattattgctgcagttaagaaagtcaaa
ctgaggtcagtaaaggaggttctgcatctttctggaccagacctgcagagactgacccgc
ctctccggccccgacgtgcagcgcttactgaaggcggcctcctcacacctgcaaggaagc
agcgtctgcacagcgctccacctgctccagcaggaggagcagttccccgagcagcacgag
cgcctgagcctgggctgccccgtgctggacgggctcctccgcggcgggctgcccctggac
ggcatcaccgagctggccggacgcagctccgccgggaagacccagctggcgctgcagctc
tgcctggccgtgcagctcccacggcgacacggaggcctggaggccggggccgtttacgtg
tgcacagaggacgccttccccagccggcgtctgcagcagctcatcgctcagcagcagcgc
ctgcggacagacgtcccaggggacgtgctcaggaaaatcaggtttggccaccagatcttc
atcgagcacgcggccgacgtggacaccctgctggagtgcgtgcataagaaggtgcctgtg
ctcctgtcgcggggcatggcccgcctggtggtcatcgactccgtggcagccccgttccgt
tgtgagttcgaccaggcggcctcggccctcagggcccggcgtctgcaggcgctgggggcc
gagctgcgccggctgagctgcatcttccggagccccgtgctgtgcatcaaccaggtgacg
gaatccacagaggagcggggtgtggcagccggcccgccgggtgtcgggggagagcgggca
tctccggccctgggcataacctggtccaaccagctcctggtgaggctgacggccgaccgg
ctgcgccccgaggaggccacctccgccccaccccgccgcaccctgagggtggtctccgcc
ccccacctgccgccttcgtcctgttcctacacagtcaccgccgagggtgtgcgggggaca
cctgggactgagtcctgctga

DBGET integrated database retrieval system