Phocoena phocoena (harbor porpoise): 136118867 Help Entry 136118867         CDS       T11058                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc00190   Oxidative phosphorylation pphc01100   Metabolic pathways pphc01524   Platinum drug resistance pphc04115   p53 signaling pathway pphc04210   Apoptosis pphc04215   Apoptosis - multiple species pphc04932   Non-alcoholic fatty liver disease pphc05010   Alzheimer disease pphc05012   Parkinson disease pphc05014   Amyotrophic lateral sclerosis pphc05016   Huntington disease pphc05017   Spinocerebellar ataxia pphc05020   Prion disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05132   Salmonella infection pphc05134   Legionellosis pphc05145   Toxoplasmosis pphc05152   Tuberculosis pphc05160   Hepatitis C pphc05161   Hepatitis B pphc05162   Measles pphc05163   Human cytomegalovirus infection pphc05164   Influenza A pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05168   Herpes simplex virus 1 infection pphc05169   Epstein-Barr virus infection pphc05170   Human immunodeficiency virus 1 infection pphc05200   Pathways in cancer pphc05210   Colorectal cancer pphc05222   Small cell lung cancer pphc05416   Viral myocarditis pphc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     136118867  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     136118867    04215 Apoptosis - multiple species     136118867    04115 p53 signaling pathway     136118867  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136118867   09162 Cancer: specific types    05210 Colorectal cancer     136118867    05222 Small cell lung cancer     136118867   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136118867    05161 Hepatitis B     136118867    05160 Hepatitis C     136118867    05164 Influenza A     136118867    05162 Measles     136118867    05168 Herpes simplex virus 1 infection     136118867    05163 Human cytomegalovirus infection     136118867    05167 Kaposi sarcoma-associated herpesvirus infection     136118867    05169 Epstein-Barr virus infection     136118867   09171 Infectious disease: bacterial    05132 Salmonella infection     136118867    05134 Legionellosis     136118867    05152 Tuberculosis     136118867   09174 Infectious disease: parasitic    05145 Toxoplasmosis     136118867   09164 Neurodegenerative disease    05010 Alzheimer disease     136118867    05012 Parkinson disease     136118867    05014 Amyotrophic lateral sclerosis     136118867    05016 Huntington disease     136118867    05017 Spinocerebellar ataxia     136118867    05020 Prion disease     136118867    05022 Pathways of neurodegeneration - multiple diseases     136118867   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136118867    05416 Viral myocarditis     136118867   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     136118867   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     136118867 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DDE_Tnp_1 CCP_MauG Motif Other DBs NCBI-GeneID:  136118867 NCBI-ProteinID:  XP_065728277 LinkDB All DBs Position 2:9558411..9558728 Genome browser AA seq 105 aa AA seqDB search MGDVEEGKKISVQKCAQCHTVEKGGKHKTGPNLHGLFGQKTGQAVGFSYTDANKNEGVTW GEETLMECLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgaggagggcaagaagatttctgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcaaaag acaggtcaggctgtcggattctcttacacagatgccaacaagaacgaaggcgtcacctgg ggagaggagacgctgatggagtgtttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagaagggagaaagggcagacttgatagcgtatctcaaa aaagctactaatgcataa

DBGET integrated database retrieval system