Phocoena phocoena (harbor porpoise): 136119304 Help Entry 136119304         CDS       T11058                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc04014   Ras signaling pathway pphc04015   Rap1 signaling pathway pphc04020   Calcium signaling pathway pphc04022   cGMP-PKG signaling pathway pphc04024   cAMP signaling pathway pphc04070   Phosphatidylinositol signaling system pphc04114   Oocyte meiosis pphc04218   Cellular senescence pphc04261   Adrenergic signaling in cardiomyocytes pphc04270   Vascular smooth muscle contraction pphc04371   Apelin signaling pathway pphc04625   C-type lectin receptor signaling pathway pphc04713   Circadian entrainment pphc04720   Long-term potentiation pphc04722   Neurotrophin signaling pathway pphc04728   Dopaminergic synapse pphc04740   Olfactory transduction pphc04744   Phototransduction pphc04750   Inflammatory mediator regulation of TRP channels pphc04910   Insulin signaling pathway pphc04912   GnRH signaling pathway pphc04915   Estrogen signaling pathway pphc04916   Melanogenesis pphc04921   Oxytocin signaling pathway pphc04922   Glucagon signaling pathway pphc04924   Renin secretion pphc04925   Aldosterone synthesis and secretion pphc04970   Salivary secretion pphc04971   Gastric acid secretion pphc05010   Alzheimer disease pphc05012   Parkinson disease pphc05022   Pathways of neurodegeneration - multiple diseases pphc05031   Amphetamine addiction pphc05034   Alcoholism pphc05133   Pertussis pphc05152   Tuberculosis pphc05163   Human cytomegalovirus infection pphc05167   Kaposi sarcoma-associated herpesvirus infection pphc05170   Human immunodeficiency virus 1 infection pphc05200   Pathways in cancer pphc05214   Glioma pphc05417   Lipid and atherosclerosis pphc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pphc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     136119304    04015 Rap1 signaling pathway     136119304    04371 Apelin signaling pathway     136119304    04020 Calcium signaling pathway     136119304    04070 Phosphatidylinositol signaling system     136119304    04024 cAMP signaling pathway     136119304    04022 cGMP-PKG signaling pathway     136119304  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     136119304    04218 Cellular senescence     136119304  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136119304   09152 Endocrine system    04910 Insulin signaling pathway     136119304    04922 Glucagon signaling pathway     136119304    04912 GnRH signaling pathway     136119304    04915 Estrogen signaling pathway     136119304    04921 Oxytocin signaling pathway     136119304    04916 Melanogenesis     136119304    04924 Renin secretion     136119304    04925 Aldosterone synthesis and secretion     136119304   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     136119304    04270 Vascular smooth muscle contraction     136119304   09154 Digestive system    04970 Salivary secretion     136119304    04971 Gastric acid secretion     136119304   09156 Nervous system    04728 Dopaminergic synapse     136119304    04720 Long-term potentiation     136119304    04722 Neurotrophin signaling pathway     136119304   09157 Sensory system    04744 Phototransduction     136119304    04740 Olfactory transduction     136119304    04750 Inflammatory mediator regulation of TRP channels     136119304   09159 Environmental adaptation    04713 Circadian entrainment     136119304  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     136119304   09162 Cancer: specific types    05214 Glioma     136119304   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     136119304    05163 Human cytomegalovirus infection     136119304    05167 Kaposi sarcoma-associated herpesvirus infection     136119304   09171 Infectious disease: bacterial    05133 Pertussis     136119304    05152 Tuberculosis     136119304   09164 Neurodegenerative disease    05010 Alzheimer disease     136119304    05012 Parkinson disease     136119304    05022 Pathways of neurodegeneration - multiple diseases     136119304   09165 Substance dependence    05031 Amphetamine addiction     136119304    05034 Alcoholism     136119304   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     136119304    05418 Fluid shear stress and atherosclerosis     136119304  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pphc01009]     136119304   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pphc04131]     136119304    03036 Chromosome and associated proteins [BR:pphc03036]     136119304   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136119304 Protein phosphatases and associated proteins [BR:pphc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      136119304 Membrane trafficking [BR:pphc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     136119304 Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      136119304 Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    136119304 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg AIF-1 EF-hand_9 Dockerin_1 EH EF_EFCAB10_C RPN13_C EAD7 Motif Other DBs NCBI-GeneID:  136119304 NCBI-ProteinID:  XP_065728828 LinkDB All DBs Position 2:complement(152063817..152064260) Genome browser AA seq 147 aa AA seqDB search MAEQLSKEQVAEFMEAFHRFDKDKDSAINTQELGAVMQELGLNPSEAALKGFIARDDADG DGVISSQEFLAVIAKGVQARARADDLRTAFHAFDLDGDGHISMDELKQAMAQLEVSQEEL DIMIREADVDRDGQVSYEEFVHVLMLK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggctgagcagctgtccaaagagcaggtggccgagttcatggaggccttccacagattc gacaaggacaaagacagtgccatcaacacccaggagctgggcgccgtgatgcaggagctg ggcctgaacccgtcagaggccgcactgaaagggttcatcgccagggacgatgcggatggg gatggtgtcatcagctcccaggagttcctggcagtgatagccaagggggttcaggctcgg gccagagcggatgacctgaggacagccttccacgccttcgacctggatggcgacggccac atcagcatggatgagctcaagcaggccatggcccagctggaggtgtcccaggaggagttg gacatcatgatccgggaagctgacgtggaccgggacgggcaggtgagctacgaggagttc gtgcacgtcctcatgctgaagtga

DBGET integrated database retrieval system