Phocoena phocoena (harbor porpoise): 136121006 Help Entry 136121006         CDS       T11058                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism pphc  Phocoena phocoena (harbor porpoise) Pathway pphc03082   ATP-dependent chromatin remodeling pphc04217   Necroptosis pphc04613   Neutrophil extracellular trap formation pphc05034   Alcoholism pphc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pphc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136121006  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136121006  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     136121006  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     136121006   09165 Substance dependence    05034 Alcoholism     136121006  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pphc03036]     136121006   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pphc04147]     136121006 Chromosome and associated proteins [BR:pphc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136121006 Exosome [BR:pphc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136121006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  136121006 NCBI-ProteinID:  XP_065730860 LinkDB All DBs Position 1:108350996..108351411 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggaaagcaaggaggcaaggcccgtgccaaggctaagtcgcgctcgtcc cgcgcaggtctgcagttcccggtggggcgagtgcaccgcctgctacgcaaaggcaactac gccgagcgggtgggggccggcgcgcccgtctacatggcggcagtcctcgagtacctgacc gccgaaatcctggagctggcgggcaacgcggcccgagacaacaagaagacgcgcatcatc cctcgtcacctgcagctggccatccgcaacgacgaggaactgaataagctgttgggcaaa gtcaccatcgcccagggtggcgttttgcccaacatccaggccgttctattaccaaagaaa actgaaagccacaaagccaaaagcaaataa

DBGET integrated database retrieval system